PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.C00524.1.p
Common NameLOC105971412, MIMGU_mgv1a010338mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB
Protein Properties Length: 316aa    MW: 34910.6 Da    PI: 8.3881
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.C00524.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.83.2e-201156147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEdell ++v+++G+++W++I++ ++ gR++k+c++rw + 
  Migut.C00524.1.p 11 KGPWSPEEDELLQRLVEKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 56
                      79******************************.***********985 PP

2Myb_DNA-binding569.1e-1865107347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++++eEde +v+a++++G++ W+tIar++  gRt++ +k++w++ 
  Migut.C00524.1.p  65 AFSPEEDETIVRAHAKFGNK-WATIARMLC-GRTDNAIKNHWNST 107
                       79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.28661IPR017930Myb domain
SuperFamilySSF466899.18E-328104IPR009057Homeodomain-like
SMARTSM007172.5E-181059IPR001005SANT/Myb domain
PfamPF002495.2E-201156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-261264IPR009057Homeodomain-like
CDDcd001671.11E-171355No hitNo description
SMARTSM007172.8E-1562110IPR001005SANT/Myb domain
PROSITE profilePS5129420.31163112IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2265111IPR009057Homeodomain-like
PfamPF002493.5E-1565107IPR001005SANT/Myb domain
CDDcd001671.82E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MSQRNDSDRI KGPWSPEEDE LLQRLVEKHG PRNWSLISKS IPGRSGKSCR LRWCNQLSPQ  60
VEHRAFSPEE DETIVRAHAK FGNKWATIAR MLCGRTDNAI KNHWNSTLKR KCVSMSEEFN  120
NFDPEAQPPL KRSASLGPAT SAFCFNPGSP SGSDMSDSSH SGHLIYRPIA RTGGISQSPP  180
DPTREPVTSL SLSLPGSDPN LNTITEPIHN PIPEPDPNHA VKPMMVPPKH PNQMISSLPP  240
PPLQTYQFSP AAQPAGVVGE KQFFSAEFLA VMQDMVRKEV RNYMAGVEPE PNGFCMQTEA  300
IRNAVVKRMG ISKID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-39101123105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-381011257159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-381011257159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-39101123105C-Myb DNA-Binding Domain
1msf_C3e-39101123105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.C00524.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0593611e-116KF059361.1 Salvia miltiorrhiza MYB-related transcription factor (MYB7) mRNA, complete cds.
GenBankKF0594711e-116KF059471.1 Salvia miltiorrhiza MYB-related transcription factor (MYB7) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012851720.10.0PREDICTED: transcription factor MYB44-like
SwissprotO231601e-88MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A022Q9Z00.0A0A022Q9Z0_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-80myb domain protein 73
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]