PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.B01597.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family GRAS
Protein Properties Length: 782aa    MW: 84283.4 Da    PI: 6.8339
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.B01597.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS338.31.4e-1034217802374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       v++L+++Ae v++g+l laq +Larl+++ sp g+p++R+a+yf+e L+  l++  +   +  ++s++s+   + ++ a+k fse+sP+++fs
  Migut.B01597.1.p 421 VDQLYKAAELVQTGNLVLAQGILARLNHHLSPIGKPFHRAAFYFKESLQLLLHQ-NN---NNNSSSSSSPFALVFKIGAYKSFSEISPLVQFS 509
                       689**************************************************9.22...2233344444459******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg.skeeleetgerLakfAeelgvpfefnvlva 183
                       ++t+NqaIle +eg++r+Hi+Dfdi++G+QW++L+q+La R    +gppsl+iT+++s+ +  ++ el+ t+e+L +fA+e++++fef+v+  
  Migut.B01597.1.p 510 NFTCNQAILENLEGSNRIHIVDFDIGYGGQWASLMQELALRGgggGGPPSLKITAFASHLTPhDQLELSLTQENLIQFASEINISFEFEVV-- 600
                       ******************************************88788*********9854335***************************8.. PP

              GRAS 184 krledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        ++++l+  + + ++ +Ea+aVnl +            +   + +L++vk+lsP++vv v++ +d+++ +F++++++al+ ys +++sl+a  
  Migut.B01597.1.p 601 -SIDSLNSGSWARSNdNEAVAVNLPVGFLANC------QMWVPLILRFVKHLSPRIVVSVDRGCDRTDLPFANHVIHALQSYSNMLESLDAV- 685
                       .777777777755555********99544433......334468*********************************************665. PP

              GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLv 368
                         + ++ +k+Er+l+++ i+++v+ + ++    +e+ ++Wr+ + ++GF+pv++s++a++qa++++++++++g++ve+++ +lvl+W++++Lv
  Migut.B01597.1.p 686 NVNIDALQKIERFLIHPGIEKIVTGRFSS----QEKTQHWRALFLSSGFSPVAFSNFAESQAECVVKRTPVRGFQVEKRQSALVLCWQRKELV 774
                       3566999****************987777....9999******************************************************** PP

              GRAS 369 svSaWr 374
                       s+SaWr
  Migut.B01597.1.p 775 SASAWR 780
                       *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.116394760IPR005202Transcription factor GRAS
PfamPF035144.7E-101421780IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MKRGTLLLFY VARIHGRKQK AENRGKGVLD LELVENNKTF FTDFGGGGGG GAAAVSSFFF  60
KKYCFLNGGF GEPTSVLDSA RTPSRPTSSS TLSSSLGGGG GSTAGGGGAA STDTAGVAAA  120
VSDTKWQQQD STTATSSNAG RPDSGLLSVP PPLQIGTATA ACGGANPEKF AMEDWESVLS  180
ESVAVSPSQE QSILRLIMGD VEDPAMGSSL NKVLQIGGAA ASEFEFSDGF GVVDQGFCGG  240
GGGDQFGSSF MPALPSFPNN NSNHRSSNLP TTNFKFSPNE TLPLHHHHHH HHQTQFDSPP  300
EMKPPIFNPN LLLNHHSQNP SFFFPLSYPH QDNNNTIFAA PPHPKRHNSG SGGSPLAGAI  360
TDTGQQELFM SQQHMQHQTH QLPHQLQLLP NHYQQKPKTT DCGGGGGAAM VDELGQQQAV  420
VDQLYKAAEL VQTGNLVLAQ GILARLNHHL SPIGKPFHRA AFYFKESLQL LLHQNNNNNS  480
SSSSSPFALV FKIGAYKSFS EISPLVQFSN FTCNQAILEN LEGSNRIHIV DFDIGYGGQW  540
ASLMQELALR GGGGGGPPSL KITAFASHLT PHDQLELSLT QENLIQFASE INISFEFEVV  600
SIDSLNSGSW ARSNDNEAVA VNLPVGFLAN CQMWVPLILR FVKHLSPRIV VSVDRGCDRT  660
DLPFANHVIH ALQSYSNMLE SLDAVNVNID ALQKIERFLI HPGIEKIVTG RFSSQEKTQH  720
WRALFLSSGF SPVAFSNFAE SQAECVVKRT PVRGFQVEKR QSALVLCWQR KELVSASAWR  780
C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3543878021375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.B01597.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843568.10.0PREDICTED: scarecrow-like protein 27
TrEMBLA0A2G9GWL50.0A0A2G9GWL5_9LAMI; Uncharacterized protein
STRINGMigut.B01597.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-142GRAS family protein