PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.18G120200.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 202aa MW: 23084 Da PI: 8.0598 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 78.1 | 6.2e-25 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien rqvtf+kRr+g lKKA+ELSvLCdae+ v ifs++gklye + Manes.18G120200.1.p 9 KRIENPVHRQVTFCKRRAGFLKKAKELSVLCDAEIGVFIFSTHGKLYELA 58 79*********************************************965 PP | |||||||
2 | K-box | 57.1 | 7.6e-20 | 90 | 174 | 16 | 100 |
K-box 16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++e+ Lkkeie Lq+ + llG ++s+ eL Le++Le + +iRs+K+e++ ++i+ l++ke l+++n++L+ k+ee Manes.18G120200.1.p 90 DAKEEIMMLKKEIEILQKGLSYLLGGRYAEMSIDELLMLERNLEIWICHIRSTKMEIMSKEIQLLRNKEGILKDANQYLQDKIEE 174 6789******************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.254 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 9.7E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-27 | 1 | 78 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.25E-39 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 4.1E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-21 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.977 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.6E-20 | 90 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MARGKVQMKR IENPVHRQVT FCKRRAGFLK KAKELSVLCD AEIGVFIFST HGKLYELATN 60 GSMQGLIEKY LNATGGSLQP DLPNQTHPLD AKEEIMMLKK EIEILQKGLS YLLGGRYAEM 120 SIDELLMLER NLEIWICHIR STKMEIMSKE IQLLRNKEGI LKDANQYLQD KIEETVELSK 180 FAAMTTNSPY PLTIQNEIFQ F* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.18G120200.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021601842.1 | 1e-148 | agamous-like MADS-box protein AGL12 | ||||
Swissprot | Q38841 | 3e-78 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A2C9U3L5 | 1e-147 | A0A2C9U3L5_MANES; Uncharacterized protein | ||||
STRING | XP_002526423.1 | 1e-114 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7566 | 31 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 7e-72 | AGAMOUS-like 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.18G120200.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|