PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.17G112700.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 180aa MW: 19584 Da PI: 7.8199 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 133.2 | 1e-41 | 10 | 109 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 +CaaCk lrrkC ++C+++pyfp e+p+kfa+vhk+FGasnv kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l Manes.17G112700.1.p 10 PCAACKSLRRKCLPNCIFSPYFPPEEPQKFAIVHKIFGASNVNKLLNEVLPHQREDAVKSLAYEAEARLKDPVYGCVGAISVLQSQVIKL 99 7***************************************************************************************** PP DUF260 91 kaelallkee 100 ++el+++++ Manes.17G112700.1.p 100 QKELDATQAD 109 ****999875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.955 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.0E-41 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MASSSYSISP CAACKSLRRK CLPNCIFSPY FPPEEPQKFA IVHKIFGASN VNKLLNEVLP 60 HQREDAVKSL AYEAEARLKD PVYGCVGAIS VLQSQVIKLQ KELDATQADL IRYASSSPSP 120 PSSVLFGRSR MGHGGSSSAS YDQNSVFYYP SPRSNETCGH TQERGDHDKP TEPSNAQDI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 6e-60 | 9 | 114 | 10 | 115 | LOB family transfactor Ramosa2.1 |
5ly0_B | 6e-60 | 9 | 114 | 10 | 115 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.17G112700.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021599051.1 | 1e-121 | LOB domain-containing protein 25-like | ||||
Refseq | XP_021599052.1 | 1e-121 | LOB domain-containing protein 25-like | ||||
Swissprot | Q8L8Q3 | 9e-61 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 1e-60 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A251IWB9 | 1e-129 | A0A251IWB9_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_025381m | 1e-120 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1091 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 2e-62 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.17G112700.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|