PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.16G039600.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 158aa MW: 17687.2 Da PI: 9.5619 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123.6 | 6.7e-39 | 38 | 96 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrknk Manes.16G039600.2.p 38 PEKIISCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKNKP 96 68999****************************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-28 | 37 | 95 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.3E-32 | 40 | 95 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.276 | 42 | 96 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 44 | 80 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MATQEVGIKL FGTTITLHAR QIKEDQNNQE NPSPEKRPEK IISCPRCKSM ETKFCYFNNY 60 NVNQPRHFCK GCQRYWTAGG ALRNVPVGAG RRKNKPPCRG GLGGFPEGCL YDGSGDVHQI 120 ELDSGLLLKE WLLVADDGSR HVYPMKRRRR SSGCQTS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.16G039600.2.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021597928.1 | 1e-112 | dof zinc finger protein DOF1.5-like | ||||
Swissprot | O22967 | 5e-57 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A2C9U8P0 | 1e-115 | A0A2C9U8P0_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_018110m | 1e-111 | (Manihot esculenta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 2e-59 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.16G039600.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|