PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.09G032700.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 117aa MW: 13138.2 Da PI: 7.9329 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 126.3 | 1.5e-39 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 +CaaCk+lrr+C+ dC+++pyfp+++p++f +vhk++Gasnv k+l++lp++ r a+++l+yeA++r++dPvyG+vg+i+ l qq++++ Manes.09G032700.1.p 5 RCAACKYLRRRCPLDCIFSPYFPSNDPERFSCVHKIYGASNVGKMLQQLPDHLRAPAADCLCYEARCRIQDPVYGCVGIISLLDQQIQTA 94 6***************************************************************************************** PP DUF260 91 kaelallkee 100 +++la++k+e Manes.09G032700.1.p 95 ENQLAETKAE 104 *****99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.037 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.0E-39 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MIYGRCAACK YLRRRCPLDC IFSPYFPSND PERFSCVHKI YGASNVGKML QQLPDHLRAP 60 AADCLCYEAR CRIQDPVYGC VGIISLLDQQ IQTAENQLAE TKAEIAVLAM HNNFHK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 8e-35 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 8e-35 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.09G032700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021624537.1 | 8e-83 | LOB domain-containing protein 24-like | ||||
Swissprot | P59467 | 2e-54 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
Swissprot | P59468 | 1e-54 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A2C9V954 | 2e-81 | A0A2C9V954_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_019527m | 3e-82 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 6e-57 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.09G032700.1.p |