Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | YABBY | 22.1 | 4.4e-07 | 28 | 89 | 95 | 156 |
YABBY 95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaa 156
++++ ++++++++++ +++ + P+k +r Psa+ f+ e + k +nP++s a a
Manes.08G091800.1.p 28 RKAATVADKSSKQKAKKEKRAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVSSVAAVGKA 89
23333447888889999999*******************999999*********98887766 PP
|
Publications
? help Back to Top |
- Comella P, et al.
Fine sequence analysis of 60 kb around the Arabidopsis thaliana AtEm1 locus on chromosome III. Plant Mol. Biol., 1999. 41(5): p. 687-700 [PMID:10645728] - Stemmer C,Leeming DJ,Franssen L,Grimm R,Grasser KD
Phosphorylation of maize and Arabidopsis HMGB proteins by protein kinase CK2alpha. Biochemistry, 2003. 42(12): p. 3503-8 [PMID:12653554] - Elo A,Lyznik A,Gonzalez DO,Kachman SD,Mackenzie SA
Nuclear genes that encode mitochondrial proteins for DNA and RNA metabolism are clustered in the Arabidopsis genome. Plant Cell, 2003. 15(7): p. 1619-31 [PMID:12837951] - Launholt D,Merkle T,Houben A,Schulz A,Grasser KD
Arabidopsis chromatin-associated HMGA and HMGB use different nuclear targeting signals and display highly dynamic localization within the nucleus. Plant Cell, 2006. 18(11): p. 2904-18 [PMID:17114349] - Kwak KJ,Kim JY,Kim YO,Kang H
Characterization of transgenic Arabidopsis plants overexpressing high mobility group B proteins under high salinity, drought or cold stress. Plant Cell Physiol., 2007. 48(2): p. 221-31 [PMID:17169924] - Launholt D,Grønlund JT,Nielsen HK,Grasser KD
Overlapping expression patterns among the genes encoding Arabidopsis chromosomal high mobility group (HMG) proteins. FEBS Lett., 2007. 581(6): p. 1114-8 [PMID:17316617] - Lildballe DL, et al.
The expression level of the chromatin-associated HMGB1 protein influences growth, stress tolerance, and transcriptome in Arabidopsis. J. Mol. Biol., 2008. 384(1): p. 9-21 [PMID:18822296] - Pedersen DS,Grasser KD
The role of chromosomal HMGB proteins in plants. Biochim. Biophys. Acta, 2010 Jan-Feb. 1799(1-2): p. 171-4 [PMID:20123078] - Pedersen DS, et al.
Nucleocytoplasmic distribution of the Arabidopsis chromatin-associated HMGB2/3 and HMGB4 proteins. Plant Physiol., 2010. 154(4): p. 1831-41 [PMID:20940346] - Schrumpfová PP,Fojtová M,Mokroš P,Grasser KD,Fajkus J
Role of HMGB proteins in chromatin dynamics and telomere maintenance in Arabidopsis thaliana. Curr. Protein Pept. Sci., 2011. 12(2): p. 105-11 [PMID:21348847] - Merkle T,Grasser KD
Unexpected mobility of plant chromatin-associated HMGB proteins. Plant Signal Behav, 2011. 6(6): p. 878-80 [PMID:21543902] - Li MW,Zhou L,Lam HM
Paraformaldehyde Fixation May Lead to Misinterpretation of the Subcellular Localization of Plant High Mobility Group Box Proteins. PLoS ONE, 2015. 10(8): p. e0135033 [PMID:26270959] - Roy A, et al.
Deciphering the role of the AT-rich interaction domain and the HMG-box domain of ARID-HMG proteins of Arabidopsis thaliana. Plant Mol. Biol., 2016. 92(3): p. 371-88 [PMID:27503561] - Stemmer C,Ritt C,Igloi GL,Grimm R,Grasser KD
Variability in Arabidopsis thaliana chromosomal high-mobility-group-1-like proteins. Eur. J. Biochem., 1997. 250(3): p. 646-52 [PMID:9461286]
|