PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.04G144400.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 212aa MW: 24251.4 Da PI: 8.9098 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.1 | 2e-18 | 24 | 71 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W +eEd++l+++++ +G ++Wk Ia++ g++R++k+c++rw++yl Manes.04G144400.1.p 24 KGAWAPEEDKKLAEVIAIHGAKRWKIIAEKAGLNRCGKSCRLRWLNYL 71 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.5 | 2.4e-16 | 77 | 122 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Manes.04G144400.1.p 77 RGNISDQEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 122 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.62 | 19 | 75 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.64E-28 | 22 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.0E-15 | 23 | 73 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-17 | 24 | 71 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-24 | 25 | 78 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.17E-10 | 26 | 71 | No hit | No description |
SMART | SM00717 | 8.2E-14 | 76 | 124 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.761 | 76 | 126 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.2E-14 | 77 | 122 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.3E-25 | 79 | 127 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.76E-10 | 81 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MTAKREHKPI EAMTNMPTKK EISKGAWAPE EDKKLAEVIA IHGAKRWKII AEKAGLNRCG 60 KSCRLRWLNY LRPNIKRGNI SDQEEDLIIR LHKLLGNRWS LIAGRLPGRT DNEVKNYWNS 120 HLCKKINQKE KQSGASIGEE SKGEKRTTEK ADTVEVTREE KQSSCNNYTG GEESNTSFNV 180 DDFFDFSNED RLNLEWMSPF LEMDGRFTGM S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-29 | 21 | 127 | 4 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.04G144400.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC217588 | 7e-37 | AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence. | |||
GenBank | GU272916 | 7e-37 | GU272916.1 Populus balsamifera isolate HAY07 haplotype A myb family transcription factor gene, partial sequence. | |||
GenBank | GU272917 | 7e-37 | GU272917.1 Populus balsamifera isolate HAY07 haplotype B myb family transcription factor gene, partial sequence. | |||
GenBank | GU272921 | 7e-37 | GU272921.1 Populus balsamifera isolate KUU07 haplotype B myb family transcription factor gene, partial sequence. | |||
GenBank | GU272927 | 7e-37 | GU272927.1 Populus balsamifera isolate NWL07 haplotype B myb family transcription factor gene, partial sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021611316.1 | 1e-156 | transcription factor MYB114-like | ||||
Swissprot | Q9SEI0 | 2e-52 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A2C9W4P6 | 1e-155 | A0A2C9W4P6_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_016142m | 1e-155 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 1e-54 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.04G144400.1.p |