PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000948645 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 179aa MW: 19650.1 Da PI: 11.055 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 95.5 | 6e-30 | 11 | 66 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 p+YVNaKQy++I++RRq+Rak+ e++ ++ rkpy+heSRh+hA+rRpRg+gGrF MDP0000948645 11 GPIYVNAKQYHGIIRRRQSRAKAVIENRA-ARLRKPYMHESRHRHAMRRPRGCGGRF 66 69***************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.0E-32 | 8 | 69 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 35.387 | 9 | 69 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.2E-23 | 12 | 34 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.4E-26 | 12 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.2E-23 | 43 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MLPLNLTTDE GPIYVNAKQY HGIIRRRQSR AKAVIENRAA RLRKPYMHES RHRHAMRRPR 60 GCGGRFLNTK TMNNGNKGTE GKQGGDGQLF RFSGSQSPEV LQSDSGTLNS SKETNGSSSN 120 ISGSEVSSMY SRGDLDRFSI NHLGPSLHSL SNMMDSARGM VIPTKWVAAG DNRCNLKV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 5e-19 | 10 | 74 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 50 | 59 | RHRHAMRRPR |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008391985.1 | 1e-128 | nuclear transcription factor Y subunit A-10-like | ||||
Swissprot | Q9M9X4 | 1e-43 | NFYA2_ARATH; Nuclear transcription factor Y subunit A-2 | ||||
TrEMBL | A0A498I4M8 | 1e-127 | A0A498I4M8_MALDO; Uncharacterized protein | ||||
STRING | XP_008351509.1 | 1e-130 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3794 | 34 | 64 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G05690.1 | 2e-34 | nuclear factor Y, subunit A2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000948645 |
Publications ? help Back to Top | |||
---|---|---|---|
|