PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000854639
Organism
Malus domestica
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB_related
Protein Properties Length: 116aa    MW: 13311.6 Da    PI: 10.3417
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000854639genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-153077148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
    MDP0000854639 30 KGLWSPEEDEKLMRYMLTSGQGCWSDIARNAGLQRCGKSCRLRWINYL 77
                     678*******************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.3482581IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-242580IPR009057Homeodomain-like
SMARTSM007173.7E-112979IPR001005SANT/Myb domain
PfamPF002493.5E-143077IPR001005SANT/Myb domain
SuperFamilySSF466891.37E-2132106IPR009057Homeodomain-like
CDDcd001671.33E-93377No hitNo description
Gene3DG3DSA:1.10.10.602.0E-881106IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MRKPESMGKD DVGGAKTISK KKMMMNKLRK GLWSPEEDEK LMRYMLTSGQ GCWSDIARNA  60
GLQRCGKSCR LRWINYLRPD LKRGAFSPQE EELIIHFHSI LGNRYTLSFS KPQCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-152110618102MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at low levels in stems and siliques, specifically in xylem. {ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:9839469}.
UniprotTISSUE SPECIFICITY: Expressed specifically in fiber and vessel cells that are undergoing secondary wall thickening in floral stems. Expressed in vessels but not in xylary fibers in the developing secondary xylem of roots. {ECO:0000269|PubMed:19808805}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in the regulation of secondary wall biosynthesis in fibers and vessels (PubMed:17890373). Transcription activator of the mannan synthase CSLA9 that recognizes and binds to the DNA consensus sequence 5'-[AG][GT]T[AT]GGT[GA]-3' cis-regulatory element of CSLA9 promoter (PubMed:24243147). Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1. Functions redundantly with MYB83 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). Is an obligate component of the transcriptional regulatory complex toward the commitment of secondary wall cellulose synthesis. Is required for functional expression of the three secondary wall CESA genes, CESA4, CESA7 and CESA8 (PubMed:23726771). {ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:23726771, ECO:0000269|PubMed:24243147}.
UniProtTranscription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by salicylic acid (SA). Positively regulated by SND1 and homolog proteins. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17890373}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9703573e-84AY970357.1 Prunus salicina clone PSX08 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008344632.22e-71transcription factor MYB83-like
SwissprotQ9C6U13e-48MYB83_ARATH; Transcription factor MYB83
SwissprotQ9LXV22e-48MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A498KDD44e-70A0A498KDD4_MALDO; Uncharacterized protein
STRINGXP_008350762.14e-81(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.18e-51myb domain protein 46
Publications ? help Back to Top
  1. Zhao Q, et al.
    Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis.
    Phytochemistry, 2015. 112: p. 170-8
    [PMID:25107662]
  2. Sakamoto S,Mitsuda N
    Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant.
    Plant Cell Physiol., 2015. 56(2): p. 299-310
    [PMID:25535195]
  3. Vargas L, et al.
    Improving total saccharification yield of Arabidopsis plants by vessel-specific complementation of caffeoyl shikimate esterase (cse) mutants.
    Biotechnol Biofuels, 2016. 9: p. 139
    [PMID:27390589]
  4. Piya S,Kihm C,Rice JH,Baum TJ,Hewezi T
    Cooperative Regulatory Functions of miR858 and MYB83 during Cyst Nematode Parasitism.
    Plant Physiol., 2017. 174(3): p. 1897-1912
    [PMID:28512179]
  5. Takeuchi M,Kegasa T,Watanabe A,Tamura M,Tsutsumi Y
    Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.
    J. Plant Res., 2018. 131(2): p. 297-305
    [PMID:28921082]