PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000788581 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 147aa MW: 16658.3 Da PI: 10.0562 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.9 | 7.7e-32 | 4 | 61 | 3 | 60 |
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 Dg++WrKYGqK+v+g+++prsYYrCts +C+v+k+ve+ ++dpk++++tYeg+Hnh+k MDP0000788581 4 DGFRWRKYGQKVVQGNPYPRSYYRCTSLKCSVRKHVETVSDDPKAFITTYEGKHNHDK 61 9*******************************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 32.638 | 1 | 62 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.6E-35 | 2 | 61 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.19E-27 | 3 | 62 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.7E-30 | 3 | 62 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.3E-25 | 4 | 60 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MTCDGFRWRK YGQKVVQGNP YPRSYYRCTS LKCSVRKHVE TVSDDPKAFI TTYEGKHNHD 60 KPLRNMNAGS SEKDTTTKEK PRLSDNITFK LWHQTVSTPC LSDKNVIWAQ RKKHTPKVTV 120 AVILIPALDA LLCYAMPIIS LGNLFA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-30 | 4 | 62 | 19 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 6e-30 | 4 | 62 | 19 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.11654 | 2e-76 | stem |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ020109 | 1e-102 | KJ020109.1 Malus hybrid cultivar TTG2 protein (TTG2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009338560.1 | 7e-48 | PREDICTED: WRKY transcription factor 44-like | ||||
Refseq | XP_018498928.1 | 7e-48 | PREDICTED: WRKY transcription factor 44-like | ||||
TrEMBL | X2F1V2 | 2e-45 | X2F1V2_9ROSA; TTG2 protein | ||||
STRING | XP_009338560.1 | 3e-47 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7118 | 34 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37260.2 | 8e-31 | WRKY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000788581 |