PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000727426
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family EIL
Protein Properties Length: 184aa    MW: 21167 Da    PI: 10.2891
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000727426genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3132.75.7e-4147133192
                    XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
           EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                    +el+krmw+d+mllk lke++k     ke  ++++++++s+eqarrkkmsraQDgiLkYMlk+me c+aqGfvYgiipekgkpv+gasd+L+
  MDP0000727426  47 DELEKRMWRDRMLLKXLKEQTKG----KEX-VDNARQRQSQEQARRKKMSRAQDGILKYMLKMMEXCKAQGFVYGIIPEKGKPVSGASDNLK 133
                    79*****************9998....777.99999*******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.4E-3647141No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MVIFEELGFS GNLDYLLAPS GXGDAAPEHE QEATVEEDYS DEEMDVDELE KRMWRDRMLL  60
KXLKEQTKGK EXVDNARQRQ SQEQARRKKM SRAQDGILKY MLKMMEXCKA QGFVYGIIPE  120
KGKPVSGASD NLKRLKEQMK GKEGVDNARQ RQSQEQARRN NRRNKLREGR SSGRKKVARG  180
RRG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162175RNKLREGRSSGRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.120800.0bud| fruit| leaf| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor acting as a positive regulator in the ethylene response pathway. Is required for ethylene responsiveness in adult plant tissues. Binds a primary ethylene response element present in the ETHYLENE-RESPONSE-FACTOR1 promoter with consequence to activate the transcription of this gene. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU7324840.0GU732484.1 Malus x domestica ethylene insensitive 3 class transcription factor (EIL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028949099.11e-102ETHYLENE INSENSITIVE 3-like 1 protein isoform X1
RefseqXP_028949100.11e-102ETHYLENE INSENSITIVE 3-like 1 protein isoform X1
SwissprotO246061e-56EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A498HVC11e-102A0A498HVC1_MALDO; Uncharacterized protein
STRINGXP_008368189.14e-83(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14993913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.18e-49EIL family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kim HG, et al.
    GDSL LIPASE1 modulates plant immunity through feedback regulation of ethylene signaling.
    Plant Physiol., 2013. 163(4): p. 1776-91
    [PMID:24170202]
  3. Zhong S, et al.
    Ethylene-orchestrated circuitry coordinates a seedling's response to soil cover and etiolated growth.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(11): p. 3913-20
    [PMID:24599595]
  4. Kim HG, et al.
    GDSL lipase 1 regulates ethylene signaling and ethylene-associated systemic immunity in Arabidopsis.
    FEBS Lett., 2014. 588(9): p. 1652-8
    [PMID:24631536]
  5. Jourda C, et al.
    Expansion of banana (Musa acuminata) gene families involved in ethylene biosynthesis and signalling after lineage-specific whole-genome duplications.
    New Phytol., 2014. 202(3): p. 986-1000
    [PMID:24716518]
  6. Zhang GB,Yi HY,Gong JM
    The Arabidopsis ethylene/jasmonic acid-NRT signaling module coordinates nitrate reallocation and the trade-off between growth and environmental adaptation.
    Plant Cell, 2014. 26(10): p. 3984-98
    [PMID:25326291]
  7. Wang J, et al.
    Arabidopsis ROOT HAIR DEFECTIVE3 is involved in nitrogen starvation-induced anthocyanin accumulation.
    J Integr Plant Biol, 2015. 57(8): p. 708-21
    [PMID:25494721]
  8. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  9. Kazan K
    Diverse roles of jasmonates and ethylene in abiotic stress tolerance.
    Trends Plant Sci., 2015. 20(4): p. 219-29
    [PMID:25731753]
  10. Yang C, et al.
    MAOHUZI6/ETHYLENE INSENSITIVE3-LIKE1 and ETHYLENE INSENSITIVE3-LIKE2 Regulate Ethylene Response of Roots and Coleoptiles and Negatively Affect Salt Tolerance in Rice.
    Plant Physiol., 2015. 169(1): p. 148-65
    [PMID:25995326]
  11. Contreras-Cornejo HA, et al.
    Mitogen-Activated Protein Kinase 6 and Ethylene and Auxin Signaling Pathways Are Involved in Arabidopsis Root-System Architecture Alterations by Trichoderma atroviride.
    Mol. Plant Microbe Interact., 2015. 28(6): p. 701-10
    [PMID:26067203]
  12. Li J,Xu HH,Liu WC,Zhang XW,Lu YT
    Ethylene Inhibits Root Elongation during Alkaline Stress through AUXIN1 and Associated Changes in Auxin Accumulation.
    Plant Physiol., 2015. 168(4): p. 1777-91
    [PMID:26109425]
  13. Street IH, et al.
    Ethylene Inhibits Cell Proliferation of the Arabidopsis Root Meristem.
    Plant Physiol., 2015. 169(1): p. 338-50
    [PMID:26149574]
  14. Ju C,Chang C
    Mechanistic Insights in Ethylene Perception and Signal Transduction.
    Plant Physiol., 2015. 169(1): p. 85-95
    [PMID:26246449]
  15. Qing D, et al.
    Quantitative and Functional Phosphoproteomic Analysis Reveals that Ethylene Regulates Water Transport via the C-Terminal Phosphorylation of Aquaporin PIP2;1 in Arabidopsis.
    Mol Plant, 2016. 9(1): p. 158-174
    [PMID:26476206]
  16. Zhang Y,Liu J,Chai J,Xing D
    Mitogen-activated protein kinase 6 mediates nuclear translocation of ORE3 to promote ORE9 gene expression in methyl jasmonate-induced leaf senescence.
    J. Exp. Bot., 2016. 67(1): p. 83-94
    [PMID:26507893]
  17. Li X,Pan Y,Chang B,Wang Y,Tang Z
    NO Promotes Seed Germination and Seedling Growth Under High Salt May Depend on EIN3 Protein in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 1203
    [PMID:26779234]
  18. Yu Y, et al.
    Salt Stress and Ethylene Antagonistically Regulate Nucleocytoplasmic Partitioning of COP1 to Control Seed Germination.
    Plant Physiol., 2016. 170(4): p. 2340-50
    [PMID:26850275]
  19. Pelagio-Flores R,Ruiz-Herrera LF,López-Bucio J
    Serotonin modulates Arabidopsis root growth via changes in reactive oxygen species and jasmonic acid-ethylene signaling.
    Physiol Plant, 2016. 158(1): p. 92-105
    [PMID:26864878]
  20. Tao S, et al.
    The THO/TREX Complex Active in miRNA Biogenesis Negatively Regulates Root-Associated Acid Phosphatase Activity Induced by Phosphate Starvation.
    Plant Physiol., 2016. 171(4): p. 2841-53
    [PMID:27329222]
  21. Song L, et al.
    The Molecular Mechanism of Ethylene-Mediated Root Hair Development Induced by Phosphate Starvation.
    PLoS Genet., 2016. 12(7): p. e1006194
    [PMID:27427911]
  22. Jeong J, et al.
    Phytochrome and Ethylene Signaling Integration in Arabidopsis Occurs via the Transcriptional Regulation of Genes Co-targeted by PIFs and EIN3.
    Front Plant Sci, 2016. 7: p. 1055
    [PMID:27486469]
  23. Tsai KJ,Lin CY,Ting CY,Shih MC
    Ethylene-Regulated Glutamate Dehydrogenase Fine-Tunes Metabolism during Anoxia-Reoxygenation.
    Plant Physiol., 2016. 172(3): p. 1548-1562
    [PMID:27677986]
  24. Zhang F, et al.
    EIN2-dependent regulation of acetylation of histone H3K14 and non-canonical histone H3K23 in ethylene signalling.
    Nat Commun, 2016. 7: p. 13018
    [PMID:27694846]
  25. Liu G, et al.
    Local Transcriptional Control of YUCCA Regulates Auxin Promoted Root-Growth Inhibition in Response to Aluminium Stress in Arabidopsis.
    PLoS Genet., 2016. 12(10): p. e1006360
    [PMID:27716807]
  26. Shen X,Li Y,Pan Y,Zhong S
    Activation of HLS1 by Mechanical Stress via Ethylene-Stabilized EIN3 Is Crucial for Seedling Soil Emergence.
    Front Plant Sci, 2016. 7: p. 1571
    [PMID:27822221]
  27. Shi H, et al.
    The Red Light Receptor Phytochrome B Directly Enhances Substrate-E3 Ligase Interactions to Attenuate Ethylene Responses.
    Dev. Cell, 2016. 39(5): p. 597-610
    [PMID:27889482]
  28. Wawrzyńska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]
  29. Zemlyanskaya EV,Levitsky VG,Oshchepkov DY,Grosse I,Mironova VV
    The Interplay of Chromatin Landscape and DNA-Binding Context Suggests Distinct Modes of EIN3 Regulation in Arabidopsis thaliana.
    Front Plant Sci, 2016. 7: p. 2044
    [PMID:28119721]
  30. He X,Jiang J,Wang CQ,Dehesh K
    ORA59 and EIN3 interaction couples jasmonate-ethylene synergistic action to antagonistic salicylic acid regulation of PDF expression.
    J Integr Plant Biol, 2017. 59(4): p. 275-287
    [PMID:28168848]
  31. Abozeid A, et al.
    Ethylene Improves Root System Development under Cadmium Stress by Modulating Superoxide Anion Concentration in Arabidopsis thaliana.
    Front Plant Sci, 2017. 8: p. 253
    [PMID:28286514]
  32. Quan R, et al.
    EIN3 and SOS2 synergistically modulate plant salt tolerance.
    Sci Rep, 2017. 7: p. 44637
    [PMID:28300216]
  33. Kim GD,Cho YH,Yoo SD
    Regulatory Functions of Cellular Energy Sensor SNF1-Related Kinase1 for Leaf Senescence Delay through ETHYLENE- INSENSITIVE3 Repression.
    Sci Rep, 2017. 7(1): p. 3193
    [PMID:28600557]
  34. Liu Y, et al.
    Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1.
    Plant Cell, 2017. 29(9): p. 2269-2284
    [PMID:28842534]
  35. Liu X,Li Y,Zhong S
    Interplay between Light and Plant Hormones in the Control of Arabidopsis Seedling Chlorophyll Biosynthesis.
    Front Plant Sci, 2017. 8: p. 1433
    [PMID:28861105]
  36. Zhang F, et al.
    EIN2 mediates direct regulation of histone acetylation in the ethylene response.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(38): p. 10274-10279
    [PMID:28874528]
  37. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  38. Liu X, et al.
    EIN3 and PIF3 Form an Interdependent Module That Represses Chloroplast Development in Buried Seedlings.
    Plant Cell, 2017. 29(12): p. 3051-3067
    [PMID:29114016]
  39. Feng Y, et al.
    Ethylene promotes root hair growth through coordinated EIN3/EIL1 and RHD6/RSL1 activity in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(52): p. 13834-13839
    [PMID:29233944]
  40. Harkey AF, et al.
    Identification of Transcriptional and Receptor Networks That Control Root Responses to Ethylene.
    Plant Physiol., 2018. 176(3): p. 2095-2118
    [PMID:29259106]
  41. Zhang F,Wang L,Ko EE,Shao K,Qiao H
    Histone Deacetylases SRT1 and SRT2 Interact with ENAP1 to Mediate Ethylene-Induced Transcriptional Repression.
    Plant Cell, 2018. 30(1): p. 153-166
    [PMID:29298835]
  42. Lv B, et al.
    Brassinosteroids regulate root growth by controlling reactive oxygen species homeostasis and dual effect on ethylene synthesis in Arabidopsis.
    PLoS Genet., 2018. 14(1): p. e1007144
    [PMID:29324765]
  43. Dou L,He K,Higaki T,Wang X,Mao T
    Ethylene Signaling Modulates Cortical Microtubule Reassembly in Response to Salt Stress.
    Plant Physiol., 2018. 176(3): p. 2071-2081
    [PMID:29431630]
  44. Meng LS,Xu MK,Wan W,Wang JY
    Integration of Environmental and Developmental (or Metabolic) Control of Seed Mass by Sugar and Ethylene Metabolisms in Arabidopsis.
    J. Agric. Food Chem., 2018. 66(13): p. 3477-3488
    [PMID:29528636]
  45. Munné-Bosch S,Simancas B,Müller M
    Ethylene signaling cross-talk with other hormones in Arabidopsis thaliana exposed to contrasting phosphate availability: Differential effects in roots, leaves and fruits.
    J. Plant Physiol., 2018. 226: p. 114-122
    [PMID:29758376]