PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000652760 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 187aa MW: 20540.6 Da PI: 8.8091 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 110.8 | 6.1e-35 | 10 | 67 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+H+h+ MDP0000652760 10 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCNVKKRVERSFDDPSIVVTTYEGQHTHP 67 8********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.3E-34 | 2 | 69 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.58E-30 | 3 | 69 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.915 | 4 | 69 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.3E-41 | 9 | 68 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.2E-27 | 10 | 67 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTSASC NVKKRVERSF DDPSIVVTTY 60 EGQHTHPSPL LPRPTLTSAS SXASASPFAP NNFAMPLIPT RTLFPHHYQQ VEPFADNSSP 120 PSSAPFNFGN YHVNGSSSSL TNATSTTTGL VHPERRFCSP ATGSALLADH GLLQDIVPSH 180 MLKQEQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-28 | 1 | 69 | 9 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 2e-28 | 1 | 69 | 9 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.6897 | 0.0 | fruit| leaf| root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX112911 | 0.0 | JX112911.1 Malus hupehensis WRKY transcription factor 23 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008381435.1 | 1e-136 | WRKY transcription factor 23 | ||||
Swissprot | O22900 | 5e-53 | WRK23_ARATH; WRKY transcription factor 23 | ||||
TrEMBL | A0A498JBK5 | 1e-134 | A0A498JBK5_MALDO; Uncharacterized protein | ||||
STRING | XP_008348682.1 | 1e-135 | (Malus domestica) | ||||
STRING | XP_008381435.1 | 1e-135 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1002 | 34 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47260.1 | 2e-41 | WRKY DNA-binding protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000652760 |
Publications ? help Back to Top | |||
---|---|---|---|
|