PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000617746 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 148aa MW: 16597.9 Da PI: 9.2641 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 72.2 | 1.6e-22 | 85 | 144 | 2 | 61 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaike 61 g+kd hsk++T +g+RdR vRls+++a++++dLq++LG+ ++sk ++WL+ + +++ MDP0000617746 85 FGGKDMHSKVCTIRGLRDRHVRLSVPTAIQLYDLQERLGLNQPSKVVDWLFDDDHNQVQL 144 689************************************************987777665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 21.829 | 87 | 145 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 1.3E-20 | 87 | 145 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MGVERYYQLA KNPATIGCRK LENGLLEGGE EQQKYSGGWL WSSMTSRECV AKEANKISSN 60 PNLSRSSTPW PRLKDPRIVC ASRAFGGKDM HSKVCTIRGL RDRHVRLSVP TAIQLYDLQE 120 RLGLNQPSKV VDWLFDDDHN QVQLLPG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zkt_A | 2e-15 | 92 | 146 | 1 | 55 | Putative transcription factor PCF6 |
5zkt_B | 2e-15 | 92 | 146 | 1 | 55 | Putative transcription factor PCF6 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.16324 | 1e-111 | fruit| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, buds, flowers and immature siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM501067 | 2e-42 | KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009365889.1 | 2e-47 | PREDICTED: transcription factor TCP13-like | ||||
Refseq | XP_009365917.1 | 2e-47 | PREDICTED: transcription factor TCP13-like | ||||
Swissprot | Q9S7W5 | 3e-33 | TCP13_ARATH; Transcription factor TCP13 | ||||
TrEMBL | A0A498HII4 | 4e-45 | A0A498HII4_MALDO; Uncharacterized protein | ||||
STRING | XP_008348175.1 | 6e-91 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF932 | 34 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G02150.1 | 5e-36 | plastid transcription factor 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000617746 |
Publications ? help Back to Top | |||
---|---|---|---|
|