PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000598428
Organism
Malus domestica
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 81aa    MW: 9316 Da    PI: 10.505
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000598428genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.63.9e-31460359
                   -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                   Dg++WrKYGqK+vkg+++prsYYr  s +C+v+k+ver ++dpk++++tYeg+Hnh+
  MDP0000598428  4 DGFRWRKYGQKVVKGNPYPRSYYRXXSLKCNVRKHVERVSDDPKAFITTYEGKHNHD 60
                   9*******************************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081132.535162IPR003657WRKY domain
SMARTSM007745.6E-32261IPR003657WRKY domain
SuperFamilySSF1182901.19E-25262IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.1E-30362IPR003657WRKY domain
PfamPF031064.7E-25460IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MTGDGFRWRK YGQKVVKGNP YPRSYYRXXS LKCNVRKHVE RVSDDPKAFI TTYEGKHNHD  60
IPLRNAHTGA SDKDTTKQKP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-301621677Probable WRKY transcription factor 4
2lex_A3e-301621677Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.116543e-98stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201097e-78KJ020109.1 Malus hybrid cultivar TTG2 protein (TTG2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028945363.14e-50WRKY transcription factor 44 isoform X2
SwissprotQ9XI908e-28WRKY4_ARATH; Probable WRKY transcription factor 4
SwissprotQ9ZQ706e-28WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A498IES42e-46A0A498IES4_MALDO; Uncharacterized protein
STRINGXP_009342013.12e-49(Pyrus x bretschneideri)
STRINGXP_009342023.12e-47(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.12e-30WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]