PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000578193 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 229aa MW: 25944.1 Da PI: 7.5936 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.1 | 6.6e-16 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l d+++++G+g W+++ + g++R++k+c++rw +yl MDP0000578193 10 KGLWTVEEDRILMDYIREHGKGKWNRVNKVTGLKRCGKSCRLRWMNYL 57 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 60.8 | 2.9e-19 | 63 | 108 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg +++eEd+l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l MDP0000578193 63 RGDFSEEEDDLIIRLHKLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 108 899*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.813 | 5 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.76E-30 | 8 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-12 | 9 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-14 | 10 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-22 | 11 | 64 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.79E-10 | 13 | 57 | No hit | No description |
PROSITE profile | PS51294 | 29.439 | 58 | 112 | IPR017930 | Myb domain |
SMART | SM00717 | 3.1E-18 | 62 | 110 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.2E-18 | 63 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-27 | 65 | 112 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.90E-14 | 66 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045165 | Biological Process | cell fate commitment | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MEGGGNEYKK GLWTVEEDRI LMDYIREHGK GKWNRVNKVT GLKRCGKSCR LRWMNYLSPN 60 VKRGDFSEEE DDLIIRLHKL LGNRWSLIAG RVPGRTDNQV KNHWNTHLSK KLGVNSKKGK 120 TKAKTYPDLE RAKKNSCTPS SNSNSELQPL PNSDSNSNIF GDDEVAAAID GFDDEIMNIK 180 DNNIGTKSGV GFSDMWEAMM IGNDLNLYSS YLLDPTLDDH YPFQFDHL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-28 | 10 | 112 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008374438.1 | 1e-169 | transcription factor WER-like isoform X1 | ||||
Swissprot | Q9SEI0 | 5e-70 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A498JJX3 | 1e-168 | A0A498JJX3_MALDO; Uncharacterized protein | ||||
STRING | XP_008374438.1 | 1e-169 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 2e-72 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000578193 |