PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000388684

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

TCP

Protein Properties

Length: 76aa MW: 8727.07 Da PI: 7.523

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000388684	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	59.4	1.4e-18	22	68	11	57
TCP 11 ihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakp 57 ++T +g+RdR vRls+++a++++dLq++LG+ ++sk ++WLl + MDP0000388684 22 VCTIRGLRDRHVRLSVPIAIQLYDLQERLGLNQPSKVVDWLLDDDHN 68 79****************************************87665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51369	15.434	13	73	IPR017887	Transcription factor TCP subgroup
Pfam	PF03634	2.3E-16	22	71	IPR005333	Transcription factor, TCP

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
MFWFGIWERS FGSGSRPEPP LVCTIRGLRD RHVRLSVPIA IQLYDLQERL GLNQPSKVVD 60 WLLDDDHNQV RLLLG*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.22987	5e-57	bud\| leaf

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269\|PubMed:25378179}.
Uniprot	TISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, buds, flowers and immature siliques, and, to a lower extent, in roots. {ECO:0000269\|PubMed:11161017, ECO:0000269\|PubMed:17307931}.

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269\|PubMed:11161017, ECO:0000269\|PubMed:17307931, ECO:0000269\|PubMed:25378179}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM501067	1e-42	KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012851715.1	1e-21	PREDICTED: transcription factor TCP13-like
Refseq	XP_025884812.1	1e-21	TCP transcription factor 5 isoform X1
Swissprot	Q9S7W5	2e-19	TCP13_ARATH; Transcription factor TCP13
TrEMBL	A0A022RZ06	3e-20	A0A022RZ06_ERYGU; Uncharacterized protein
TrEMBL	A0A1U8A5K3	4e-20	A0A1U8A5K3_NELNU; transcription factor TCP2-like
STRING	XP_008348175.1	3e-28	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF932	34	119

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G02150.1	6e-22	plastid transcription factor 1

Link Out ? help Back to Top
Phytozome	MDP0000388684

Publications ? help Back to Top
Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature. Differentiation, 2010. 80(1): p. 1-8 [PMID:20219281] Yamburenko MV,Zubo YO,Börner T Abscisic acid affects transcription of chloroplast genes via protein phosphatase 2C-dependent activation of nuclear genes: repression by guanosine-3'-5'-bisdiphosphate and activation by sigma factor 5. Plant J., 2015. 82(6): p. 1030-41 [PMID:25976841] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]