PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000373350
Organism
Malus domestica
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 127aa    MW: 14337.3 Da    PI: 9.8513
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000373350genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP739.5e-2364121259
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpai 59 
                     g+kdrhsk++T +g+ dR vRls+++a++++dLq++LG+ ++sk ++WLl +   ++
  MDP0000373350  64 FGGKDRHSKVCTIRGLQDRQVRLSVPTAIQLYDLQERLGLNQPSKVVDWLLDDDHNQV 121
                    689************************************************9866655 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.5E-2166124IPR005333Transcription factor, TCP
PROSITE profilePS5136922.11666124IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MGVERYYQLA KNPTTIGCRK LENGLPEGGE EHQKYSGGRL WSSTTPRECP RLKDPRIVRA  60
SRAFGGKDRH SKVCTIRGLQ DRQVRLSVPT AIQLYDLQER LGLNQPSKVV DWLLDDDHNQ  120
VRLLPG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-1571125155Putative transcription factor PCF6
5zkt_B4e-1571125155Putative transcription factor PCF6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.163248e-91fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}.
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, buds, flowers and immature siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5010677e-45KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012851715.19e-38PREDICTED: transcription factor TCP13-like
RefseqXP_025884812.17e-38TCP transcription factor 5 isoform X1
SwissprotQ9S7W56e-34TCP13_ARATH; Transcription factor TCP13
TrEMBLA0A022RZ062e-36A0A022RZ06_ERYGU; Uncharacterized protein
STRINGXP_008348175.12e-77(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.19e-37plastid transcription factor 1
Publications ? help Back to Top
  1. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  2. Yamburenko MV,Zubo YO,Börner T
    Abscisic acid affects transcription of chloroplast genes via protein phosphatase 2C-dependent activation of nuclear genes: repression by guanosine-3'-5'-bisdiphosphate and activation by sigma factor 5.
    Plant J., 2015. 82(6): p. 1030-41
    [PMID:25976841]
  3. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]