PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000331808
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family YABBY
Protein Properties Length: 185aa    MW: 20461.4 Da    PI: 8.9179
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000331808genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY229.21.1e-7061655170
          YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssek 100
                     +se+vCyv+CnfCntilavsvP +sl ++vtvrCGhC++llsvn   + q ++   +  +  k++l  e+ +  +n+ s  ++++s+s++  +  
  MDP0000331808   6 MASERVCYVHCNFCNTILAVSVPCNSLXNMVTVRCGHCANLLSVNTGGSLQSTTIPPQ--DPQKQHLSSEDSN--KNCGSSSSSSSSKSNKFGH-A 96 
                    579**********************************************999999997..4444444444433..3334433333333333333.4 PP

          YABBY 101 lsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                    +++ e +e prv p i PPekrqrvPsaynrfikeeiqrikasnPdishreafs aaknWahfP+ihfgl
  MDP0000331808  97 FESLELHEQPRVSP-IPPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSKAAKNWAHFPHIHFGL 165
                    46777888899888.89***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046907.9E-727165IPR006780YABBY protein
SuperFamilySSF470951.13E-8109158IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.7E-5114157IPR009071High mobility group box domain
CDDcd013908.46E-6119155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSMDLMASER VCYVHCNFCN TILAVSVPCN SLXNMVTVRC GHCANLLSVN TGGSLQSTTI  60
PPQDPQKQHL SSEDSNKNCG SSSSSSSSKS NKFGHAFESL ELHEQPRVSP IPPPEKRQRV  120
PSAYNRFIKE EIQRIKASNP DISHREAFSK AAKNWAHFPH IHFGLKLDXN KQPKLDQAFA  180
GKGTX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.120990.0fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}.
UniprotTISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10457020}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008385589.21e-134putative axial regulator YABBY 2 isoform X2
SwissprotQ9XFB07e-77YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLD9ZJG51e-108D9ZJG5_MALDO; YABBY domain class transcription factor
STRINGXP_009378606.11e-108(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-71YABBY family protein
Publications ? help Back to Top
  1. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]