PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000301320 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 110aa MW: 12088.6 Da PI: 9.6795 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 98.7 | 1.2e-30 | 5 | 102 | 3 | 101 |
DUF822 3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 sg +++ E+E++k RER+RRai++ki+ LR++ +y+l r D+neVl+ L++eAGw+ve+D ttyr p a g+ + ++p + ++ ++ MDP0000301320 5 SGSGRSESEKEKTKIRERQRRAITTKIFHSLRKHRGYRLFPRGDINEVLRHLATEAGWLVEPDDTTYRPPNAPS-CYPACGTPKATTPVATSTPTP 99 666678899***********************************************************777777.555555555555555544455 PP DUF822 99 kss 101 +ss MDP0000301320 100 SSS 102 444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 1.7E-27 | 8 | 97 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MAGTSGSGRS ESEKEKTKIR ERQRRAITTK IFHSLRKHRG YRLFPRGDIN EVLRHLATEA 60 GWLVEPDDTT YRPPNAPSCY PACGTPKATT PVATSTPTPS SSMVIEGGEC |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009344419.1 | 2e-56 | PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like | ||||
Swissprot | O80831 | 2e-16 | BAM7_ARATH; Beta-amylase 7 | ||||
TrEMBL | A0A498HK27 | 8e-75 | A0A498HK27_MALDO; Uncharacterized protein | ||||
STRING | XP_008389172.1 | 4e-70 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13979 | 16 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G45300.1 | 3e-14 | beta-amylase 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000301320 |
Publications ? help Back to Top | |||
---|---|---|---|
|