PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000291729
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family YABBY
Protein Properties Length: 182aa    MW: 20182.9 Da    PI: 8.2617
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000291729genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY170.89.3e-53131674163
          YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                    ++ se++Cyv+CnfCnt+lav +P + l+ +vtv+CGhC++l  ++ +   q +   +h  +sl+ +  ++  +e+++   n+ k++++sts s  
  MDP0000291729  13 NQPSEHLCYVRCNFCNTVLAVGIPCKRLMDTVTVKCGHCSNLSFLSTRPPLQGQCLPDH-PTSLTLQESDQYWNEKQAGCCNDFKKDQSSTSSS-- 105
                    5789*************************************988888888888888887.3344444444444555555556666555555444.. PP

          YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                      + ++d  +p++p v++PPek+ r Psaynrf+k+eiqrika+nP+i hreafsaaaknWa +
  MDP0000291729 106 --PVSSDPPSPKAPFVVKPPEKKHRLPSAYNRFMKDEIQRIKAANPEIPHREAFSAAAKNWARY 167
                    ..35678899****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.3E-5615167IPR006780YABBY protein
SuperFamilySSF470959.03E-9111165IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.105.6E-5121166IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MNMEEKVTMD LINQPSEHLC YVRCNFCNTV LAVGIPCKRL MDTVTVKCGH CSNLSFLSTR  60
PPLQGQCLPD HPTSLTLQES DQYWNEKQAG CCNDFKKDQS STSSSPVSSD PPSPKAPFVV  120
KPPEKKHRLP SAYNRFMKDE IQRIKAANPE IPHREAFSAA AKNWARYIPC QSSAAGSGSG  180
SY
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269|PubMed:14729915}.
Functional Description ? help Back to Top
Source Description
UniProtRegulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6272501e-137AB627250.1 Malus x domestica mRNA, microsatellite: MEST098, clone: FLW01_10_E08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339784.11e-104protein CRABS CLAW isoform X1
SwissprotQ76EJ02e-64YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLA0A498IBD41e-102A0A498IBD4_MALDO; Uncharacterized protein
STRINGXP_008339784.11e-103(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF102593040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.13e-64YABBY family protein