PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000277239 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 130aa MW: 14936.3 Da PI: 10.0443 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 133.1 | 1.1e-41 | 15 | 105 | 1 | 91 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg ++ ++++l++ k MDP0000277239 15 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGQFRLYNNKLMCFK 105 7**********************************************************************************99998766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.462 | 14 | 115 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.5E-41 | 15 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MKENGSSRKQ GAPSPCAACK LLRRRCAQDC VFAPYFPADE PQKFANVHKV FGASNVNKML 60 QELPEHQRGD AVSSMVYEAN ARVRDPVYGC VGQFRLYNNK LMCFKPNWLW LRQRWCTSKC 120 VRPHHSRTMG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-43 | 11 | 101 | 7 | 97 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-43 | 11 | 101 | 7 | 97 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.11462 | 0.0 | cell culture| fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008359794.2 | 9e-64 | LOB domain-containing protein 4-like | ||||
Refseq | XP_009353911.1 | 8e-64 | PREDICTED: LOB domain-containing protein 4 | ||||
Refseq | XP_009371914.1 | 1e-63 | PREDICTED: LOB domain-containing protein 4-like | ||||
Swissprot | Q9SHE9 | 1e-56 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A498JUR4 | 2e-61 | A0A498JUR4_MALDO; Uncharacterized protein | ||||
STRING | XP_009353911.1 | 3e-63 | (Pyrus x bretschneideri) | ||||
STRING | XP_009371914.1 | 4e-63 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1334 | 34 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 5e-59 | LOB domain-containing protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000277239 |