PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000265429 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 176aa MW: 19667.1 Da PI: 7.2898 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 143.2 | 7.9e-45 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+ MDP0000265429 7 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLAV 102 7*********************************************************************************************** PP DUF260 97 lkee 100 +++e MDP0000265429 103 AQAE 106 9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.823 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 7.5E-44 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009965 | Biological Process | leaf morphogenesis |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MGSGSSPCAS CKLLRRRCAK DCIFAPYFPS DDPHKFAIVH KVFGASNVSK MLQELPIHQR 60 GDAVSSLVYE ANARVRDPVY GCVGAISFLQ NQVSQLQMQL AVAQAEILCI QMQQEPVALP 120 TQIDQHQHXH HHQDHDQKSL LLSNSDINSI PHQYFSSFAS PSNVIQDPLK RESLWT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-50 | 2 | 121 | 7 | 128 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-50 | 2 | 121 | 7 | 128 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.1439 | 0.0 | leaf| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FQ378626 | 8e-98 | FQ378626.1 Vitis vinifera clone SS0AEB13YA05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008384740.2 | 1e-128 | LOB domain-containing protein 12 | ||||
Swissprot | Q8LBW3 | 1e-82 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | A0A498IRV6 | 1e-126 | A0A498IRV6_MALDO; Uncharacterized protein | ||||
STRING | XP_008384740.1 | 1e-127 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1664 | 34 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 1e-80 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000265429 |
Publications ? help Back to Top | |||
---|---|---|---|
|