PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000263900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 135aa MW: 15579.3 Da PI: 10.0878 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.2 | 1.2e-31 | 68 | 126 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC vkk+v+r ++d+ +v++tY g H+h+ MDP0000263900 68 LDDGYRWRKYGQKFVKNNKFPRSYYRCTHRGCIVKKQVQRHSKDEGIVVTTYDGIHTHR 126 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.4E-32 | 53 | 126 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-29 | 60 | 127 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.195 | 63 | 128 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.3E-35 | 68 | 127 | IPR003657 | WRKY domain |
Pfam | PF03106 | 9.9E-26 | 69 | 126 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MDQNNQIFFL GSSTTSPAFL TCSANQSSFP HFRSDRSEGL MKSGGKEGDK ESKKHKYAFQ 60 TRSQVDILDD GYRWRKYGQK FVKNNKFPRS YYRCTHRGCI VKKQVQRHSK DEGIVVTTYD 120 GIHTHRVDEN SAGNF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-27 | 58 | 125 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 6e-27 | 58 | 125 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018503653.1 | 8e-90 | PREDICTED: probable WRKY transcription factor 43 | ||||
Swissprot | Q9S763 | 1e-38 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
TrEMBL | A0A498I222 | 2e-96 | A0A498I222_MALDO; Uncharacterized protein | ||||
STRING | XP_008346674.1 | 3e-62 | (Malus domestica) | ||||
STRING | XP_008374228.1 | 3e-62 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01970.1 | 1e-40 | WRKY DNA-binding protein 45 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000263900 |
Publications ? help Back to Top | |||
---|---|---|---|
|