PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000261432 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 149aa MW: 16430.2 Da PI: 7.1725 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 75.8 | 1.4e-23 | 6 | 80 | 4 | 79 |
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkvee 79 + ++eq+Cy+ CnfC+ +lavsvP +slf +vtvrCG Ct+l svn+a a q l+ ++ + + + ++ + ++ MDP0000261432 6 DVATEQLCYIPCNFCSIVLAVSVPCSSLFDIVTVRCGRCTNLWSVNMAAAFQSLSWQDV-QAQNYNCNSQNYRIDS 80 5689***********************************************99999985.5555444445544433 PP | |||||||
2 | YABBY | 44.9 | 4.5e-14 | 110 | 134 | 135 | 159 |
YABBY 135 eeiqrikasnPdishreafsaaakn 159 eeiqrika+nPdishreafs+aakn MDP0000261432 110 EEIQRIKANNPDISHREAFSTAAKN 134 9***********************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 8.2E-26 | 8 | 88 | IPR006780 | YABBY protein |
Pfam | PF04690 | 3.5E-12 | 110 | 134 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MTSCVDVATE QLCYIPCNFC SIVLAVSVPC SSLFDIVTVR CGRCTNLWSV NMAAAFQSLS 60 WQDVQAQNYN CNSQNYRIDS GSSSKCNKKN ATGDPTLDPC HGRKGCEPTE EIQRIKANNP 120 DISHREAFST AAKNDPEKHL MSRXALLNN |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.13276 | 1e-144 | bud| leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009364015.1 | 2e-83 | PREDICTED: axial regulator YABBY 5-like | ||||
Swissprot | Q8GW46 | 3e-46 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | D9ZJG6 | 5e-80 | D9ZJG6_MALDO; YABBY domain class transcription factor | ||||
STRING | XP_009364015.1 | 7e-83 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1124 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 1e-48 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000261432 |
Publications ? help Back to Top | |||
---|---|---|---|
|