PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000255162

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

SBP

Protein Properties

Length: 163aa MW: 18659.7 Da PI: 10.0431

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000255162	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	126.1	1.4e-39	60	136	1	77
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cq+++C+adls+ k+yhr+hkvC+ hsk++vvlvsgl+qrfCqqCsrfhe sefD++krsCr+rL++hnerrrk+ MDP0000255162 60 RCQADRCTADLSDEKKYHRKHKVCDLHSKSQVVLVSGLHQRFCQQCSRFHEXSEFDDTKRSCRSRLSGHNERRRKNP 136 6**************************************************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	2.7E-31	53	122	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	30.325	58	135	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.94E-36	59	139	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.9E-29	61	134	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MEGMSKLDSD KQMKEKPHVV VVVVKKEEEE FDDELQVDRM KKGKRSLSSS SGGGGGAMRR 60 CQADRCTADL SDEKKYHRKH KVCDLHSKSQ VVLVSGLHQR FCQQCSRFHE XSEFDDTKRS 120 CRSRLSGHNE RRRKNPAESH AVEGSSRNVG TRTQSTHKHF QIK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	5e-35	50	134	2	84	squamosa promoter binding protein-like 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.16564	1e-135	stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:14573523}.
Uniprot	TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269\|PubMed:10524240}.

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16914499}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305\|PubMed:12202040, ECO:0000305\|PubMed:16914499}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008342891.2	4e-84	squamosa promoter-binding protein 1-like
Swissprot	Q9S7A9	2e-39	SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBL	A0A498HIG4	7e-82	A0A498HIG4_MALDO; Uncharacterized protein
STRING	XP_008342891.1	1e-114	(Malus domestica)
STRING	XP_008362441.1	1e-114	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G53160.2	1e-39	squamosa promoter binding protein-like 4

Link Out ? help Back to Top
Phytozome	MDP0000255162

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Hyun Y, et al. Site-directed mutagenesis in Arabidopsis thaliana using dividing tissue-targeted RGEN of the CRISPR/Cas system to generate heritable null alleles. Planta, 2015. 241(1): p. 271-84 [PMID:25269397] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Ioannidi E, et al. Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]