PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000255162 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 163aa MW: 18659.7 Da PI: 10.0431 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 126.1 | 1.4e-39 | 60 | 136 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cq+++C+adls+ k+yhr+hkvC+ hsk++vvlvsgl+qrfCqqCsrfhe sefD++krsCr+rL++hnerrrk+ MDP0000255162 60 RCQADRCTADLSDEKKYHRKHKVCDLHSKSQVVLVSGLHQRFCQQCSRFHEXSEFDDTKRSCRSRLSGHNERRRKNP 136 6**************************************************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.7E-31 | 53 | 122 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 30.325 | 58 | 135 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.94E-36 | 59 | 139 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.9E-29 | 61 | 134 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MEGMSKLDSD KQMKEKPHVV VVVVKKEEEE FDDELQVDRM KKGKRSLSSS SGGGGGAMRR 60 CQADRCTADL SDEKKYHRKH KVCDLHSKSQ VVLVSGLHQR FCQQCSRFHE XSEFDDTKRS 120 CRSRLSGHNE RRRKNPAESH AVEGSSRNVG TRTQSTHKHF QIK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 5e-35 | 50 | 134 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.16564 | 1e-135 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008342891.2 | 4e-84 | squamosa promoter-binding protein 1-like | ||||
Swissprot | Q9S7A9 | 2e-39 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A498HIG4 | 7e-82 | A0A498HIG4_MALDO; Uncharacterized protein | ||||
STRING | XP_008342891.1 | 1e-114 | (Malus domestica) | ||||
STRING | XP_008362441.1 | 1e-114 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 1e-39 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000255162 |