PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000239602

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

HSF

Protein Properties

Length: 136aa MW: 15756 Da PI: 10.3876

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000239602	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	95.7	4.8e-30	52	120	1	69
HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SS CS HSF_DNA-bind 1 aFlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdee 69 +Fl+k++++++d+e++++isws+ +sf+v+d ef++++Lpk+Fkh+nf+SF+RQLn+YgF+kv+++ MDP0000239602 52 TFLNKTFQMVDDPETDSIISWSDARQSFIVWDLYEFSRTLLPKHFKHNNFSSFIRQLNTYGFRKVDQDM 120 6****************************************************************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	3.9E-31	45	119	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	2.5E-35	49	132	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	4.08E-26	49	118	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	2.2E-25	53	119	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.9E-20	53	76	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.9E-20	91	103	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PROSITE pattern	PS00434	0	92	116	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.9E-20	104	116	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MSEPHLPSPH PPLYSLSLPT LPLLQPTREP PHSIRAPRSL SSTKFARGGP TTFLNKTFQM 60 VDDPETDSII SWSDARQSFI VWDLYEFSRT LLPKHFKHNN FSSFIRQLNT YGFRKVDQDM 120 LKGFRREDAG PRWKIG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	9e-21	52	116	28	92	Heat shock factor protein 1
5d5v_B	9e-21	52	116	28	92	Heat shock factor protein 1
5d5v_D	9e-21	52	116	28	92	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress responses. Seems to be involved in other environmental stress responses. Activates ascorbate peroxidase 2 (APX2) in addition to several heat shock protein (HSPs). {ECO:0000269\|PubMed:16649111, ECO:0000269\|PubMed:17059409, ECO:0000269\|PubMed:17085506}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress, high light and hydrogen peroxide (H(2)O(2)). {ECO:0000269\|PubMed:16649111, ECO:0000269\|PubMed:17059409, ECO:0000269\|PubMed:17085506}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008388138.2	1e-39	heat stress transcription factor A-2-like
Refseq	XP_008388143.2	1e-39	heat stress transcription factor A-2-like
Swissprot	O80982	1e-29	HSFA2_ARATH; Heat stress transcription factor A-2
TrEMBL	A0A498KFB6	6e-38	A0A498KFB6_MALDO; Uncharacterized protein
STRING	XP_009361628.1	1e-38	(Pyrus x bretschneideri)
STRING	XP_008388138.1	1e-38	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G26150.1	1e-32	heat shock transcription factor A2

Link Out ? help Back to Top
Phytozome	MDP0000239602

Publications ? help Back to Top
Liu HC,Charng YY Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] Jung HS, et al. Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] Chauhan H,Khurana N,Agarwal P,Khurana JP,Khurana P A seed preferential heat shock transcription factor from wheat provides abiotic stress tolerance and yield enhancement in transgenic Arabidopsis under heat stress environment. PLoS ONE, 2013. 8(11): p. e79577 [PMID:24265778] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Weng M, et al. Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana. Plant Cell Environ., 2014. 37(9): p. 2128-38 [PMID:24548003] Jang YH, et al. A homolog of splicing factor SF1 is essential for development and is involved in the alternative splicing of pre-mRNA in Arabidopsis thaliana. Plant J., 2014. 78(4): p. 591-603 [PMID:24580679] Stief A, et al. Arabidopsis miR156 Regulates Tolerance to Recurring Environmental Stress through SPL Transcription Factors. Plant Cell, 2014. 26(4): p. 1792-1807 [PMID:24769482] Dobrá J, et al. The impact of heat stress targeting on the hormonal and transcriptomic response in Arabidopsis. Plant Sci., 2015. 231: p. 52-61 [PMID:25575991] Yamauchi Y,Kunishima M,Mizutani M,Sugimoto Y Reactive short-chain leaf volatiles act as powerful inducers of abiotic stress-related gene expression. Sci Rep, 2015. 5: p. 8030 [PMID:25619826] Shi H, et al. Melatonin induces class A1 heat-shock factors (HSFA1s) and their possible involvement of thermotolerance in Arabidopsis. J. Pineal Res., 2015. 58(3): p. 335-42 [PMID:25711624] Mueller SP,Krause DM,Mueller MJ,Fekete A Accumulation of extra-chloroplastic triacylglycerols in Arabidopsis seedlings during heat acclimation. J. Exp. Bot., 2015. 66(15): p. 4517-26 [PMID:25977236] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Nguyen AH, et al. Loss of Arabidopsis 5'-3' Exoribonuclease AtXRN4 Function Enhances Heat Stress Tolerance of Plants Subjected to Severe Heat Stress. Plant Cell Physiol., 2015. 56(9): p. 1762-72 [PMID:26136597] Hu Z, et al. Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis. Plant J., 2015. 84(6): p. 1178-91 [PMID:26576681] Lämke J,Brzezinka K,Bäurle I HSFA2 orchestrates transcriptional dynamics after heat stress in Arabidopsis thaliana. Transcription, 2016. 7(4): p. 111-4 [PMID:27383578] Wang X,Huang W,Liu J,Yang Z,Huang B Molecular regulation and physiological functions of a novel FaHsfA2c cloned from tall fescue conferring plant tolerance to heat stress. Plant Biotechnol. J., 2017. 15(2): p. 237-248 [PMID:27500592] Chen ST,He NY,Chen JH,Guo FQ Identification of core subunits of photosystem II as action sites of HSP21, which is activated by the GUN5-mediated retrograde pathway in Arabidopsis. Plant J., 2017. 89(6): p. 1106-1118 [PMID:27943531] Kataoka R,Takahashi M,Suzuki N Coordination between bZIP28 and HSFA2 in the regulation of heat response signals in Arabidopsis. Plant Signal Behav, 2017. 12(11): p. e1376159 [PMID:28873003] Wang X,Zhuang L,Shi Y,Huang B Up-Regulation of HSFA2c and HSPs by ABA Contributing to Improved Heat Tolerance in Tall Fescue and Arabidopsis. Int J Mol Sci, 2018. [PMID:28914758] Llamas E,Pulido P,Rodriguez-Concepcion M Interference with plastome gene expression and Clp protease activity in Arabidopsis triggers a chloroplast unfolded protein response to restore protein homeostasis. PLoS Genet., 2017. 13(9): p. e1007022 [PMID:28937985] Li X, et al. Plastid Translation Elongation Factor Tu Is Prone to Heat-Induced Aggregation Despite Its Critical Role in Plant Heat Tolerance. Plant Physiol., 2018. 176(4): p. 3027-3045 [PMID:29444814]