PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000203462 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 103aa MW: 11572.4 Da PI: 9.6556 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 159.8 | 1.8e-49 | 5 | 76 | 1 | 72 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkg 72 g+sgr ptwkErEnnkrRERrRRaiaak+y+GLRaqG yklpk++DnneVlkALc+eAGwvve+DGttyrk MDP0000203462 5 GSSGRLPTWKERENNKRRERRRRAIAAKMYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKI 76 689*******************************************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 1.8E-45 | 6 | 77 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MTGGGSSGRL PTWKERENNK RRERRRRAIA AKMYSGLRAQ GSYKLPKHCD NNEVLKALCA 60 EAGWVVEEDG TTYRKISACK IILDLVLVDF VNPCFLVEIP AGF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 9e-26 | 9 | 80 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 9e-26 | 9 | 80 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 9e-26 | 9 | 80 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 9e-26 | 9 | 80 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.12130 | 1e-104 | bud| cell culture| fruit| leaf| stem |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008338783.2 | 7e-36 | BES1/BZR1 homolog protein 2-like | ||||
Refseq | XP_010675300.1 | 3e-36 | PREDICTED: BES1/BZR1 homolog protein 4 | ||||
Swissprot | Q9S7F3 | 3e-28 | BEH1_ARATH; BES1/BZR1 homolog protein 1 | ||||
TrEMBL | A0A2P6RMR5 | 2e-45 | A0A2P6RMR5_ROSCH; Putative transcription factor BES/BZR family | ||||
STRING | XP_010675300.1 | 1e-35 | (Beta vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15152 | 11 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50750.1 | 4e-30 | BES1/BZR1 homolog 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000203462 |