![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000192940 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 218aa MW: 24336.5 Da PI: 8.1736 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 223.7 | 5.2e-69 | 10 | 181 | 2 | 170 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes...hldeslkeelleelkveeenlks...nvekees 91 d+ seq+Cyv+Cn C+t lavsvP tslfk+vtvrCGhCt+ll+vn++ qll++++ hl++s+ + + l+ ee ++ n +++ MDP0000192940 10 DHLPPSEQLCYVHCNICDTGLAVSVPCTSLFKTVTVRCGHCTNLLTVNMR--GQLLPSSNqfhHLGHSFFSSPNNSLNLLEEIPNVptpNFLVNHT 103 577899***************************************97665..56666665111566666655444443333332220013344444 PP YABBY 92 astsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 + ++ + + de+ pr+p ++rPPekrqrvPsaynrfik+eiqrik+ nPdishreafsaaaknWahfP+ihfgl MDP0000192940 104 NVNDFAGTP-RGGADEHFPRPPVINRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGL 181 444444433.67899*****999******************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 7.2E-68 | 14 | 181 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.05E-7 | 124 | 174 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 2.7E-4 | 129 | 175 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MSSSSTLSLD HLPPSEQLCY VHCNICDTGL AVSVPCTSLF KTVTVRCGHC TNLLTVNMRG 60 QLLPSSNQFH HLGHSFFSSP NNSLNLLEEI PNVPTPNFLV NHTNVNDFAG TPRGGADEHF 120 PRPPVINRPP EKRQRVPSAY NRFIKDEIQR IKSVNPDISH REAFSAAAKN WAHFPHIHFG 180 LMPDQTVKKT TIRQQEGEDV LMKDGFLSSA NNVRVSPY |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo the expression starts during the transition between globular and heart stages in the cotyledon anlagen. From the heart stage, expression expands to abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in abaxial regions of young lateral aerial organs, and in primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:14555697, ECO:0000269|Ref.3}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT148410 | 6e-65 | BT148410.1 Lotus japonicus clone JCVI-FLLj-6P15 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008381158.1 | 1e-162 | axial regulator YABBY 1-like | ||||
Swissprot | O22152 | 4e-82 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | A0A498JVU4 | 1e-137 | A0A498JVU4_MALDO; Uncharacterized protein | ||||
STRING | XP_008381158.1 | 1e-162 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2040 | 34 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 9e-79 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000192940 |