PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000171878
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family YABBY
Protein Properties Length: 206aa    MW: 22447.4 Da    PI: 8.4277
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000171878genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY163.12.2e-50131684163
          YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                    ++ se++Cyv+CnfCnt+lav +P + l+ ++tv+CGhC++l  ++ +   + +   +h  +sl+ +  ++  +e+++   n+ ++ ++s+s ss 
  MDP0000171878  13 NQPSENLCYVRCNFCNTVLAVGLPCKRLMDTITVKCGHCSNLSFLSTRSPLEGQCLPDH-PTSLTLQESDQYLNEKQAGCCNDFRKGQSSSSSSS- 106
                    5789*************************************977666666666666666.33444344444445555666666776666666666. PP

          YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                      + + +  +p++p v++PPek+ r Psaynrf+k+ei+rika+nP++ hreafsaaaknWa +
  MDP0000171878 107 --PVSGNPPSPKAPFVVKPPEKKHRLPSAYNRFMKDEIKRIKAANPEVPHREAFSAAAKNWARY 168
                    ..45667789999*************************************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046907.3E-5415168IPR006780YABBY protein
SuperFamilySSF470958.77E-9112167IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.105.3E-5122167IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MSMEEKVTMD FINQPSENLC YVRCNFCNTV LAVGLPCKRL MDTITVKCGH CSNLSFLSTR  60
SPLEGQCLPD HPTSLTLQES DQYLNEKQAG CCNDFRKGQS SSSSSSPVSG NPPSPKAPFV  120
VKPPEKKHRL PSAYNRFMKD EIKRIKAANP EVPHREAFSA AAKNWARYIP SQSSAGSGSG  180
SCSNNNGSDF AGMNMLATCC QNPKTP
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269|PubMed:14729915}.
UniprotDEVELOPMENTAL STAGE: In carpels, expression starts when the gynoecial primordia becomes distinct. First expressed in the lateral region of each carpel. Later resolves into two distinct domains, epidermal and internal. In epidermal tissues, mostly localized on the outer surface, successively from the base to the tip of the gynoecium and finally confined to the valve region before disappearing during last flowering stages. In internal tissues, first confined to four discrete zones adjacent to the future placental tissue occupying the full length of the elongating cylinder, declining from the apical regions and disappearing after the ovule primordia arise. Before nectaries initiation, expression occupies a ring of receptacle cells between the stamen and sepal primordia, from where nectaries will develop. Strongly expressed in nectaries until latest flowering stages. {ECO:0000269|PubMed:10225998}.
UniprotTISSUE SPECIFICITY: Restricted to flowers, mostly in carpels and nectaries. Expressed at low levels in sepal primordia (buds), sepal receptacle and developing petal. Not detected in placental tissues, septum, stigma and ovules. {ECO:0000269|PubMed:10225998}.
Functional Description ? help Back to Top
Source Description
UniProtRegulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}.
UniProtTranscription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6272507e-37AB627250.1 Malus x domestica mRNA, microsatellite: MEST098, clone: FLW01_10_E08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017192417.11e-114protein CRABS CLAW isoform X1
SwissprotQ76EJ01e-59YABDL_ORYSJ; Protein DROOPING LEAF
SwissprotQ8L9258e-60CRC_ARATH; Protein CRABS CLAW
TrEMBLA0A498IBD41e-109A0A498IBD4_MALDO; Uncharacterized protein
STRINGXP_008389393.11e-112(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF102593040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.15e-61YABBY family protein
Publications ? help Back to Top
  1. Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C
    The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development.
    Ann. Bot., 2014. 114(7): p. 1535-44
    [PMID:24989787]
  2. Pfannebecker KC,Lange M,Rupp O,Becker A
    Seed Plant-Specific Gene Lineages Involved in Carpel Development.
    Mol. Biol. Evol., 2017. 34(4): p. 925-942
    [PMID:28087776]
  3. Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T
    Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation.
    Nat Commun, 2017. 8(1): p. 1125
    [PMID:29066759]
  4. Yamaguchi N, et al.
    Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy.
    Nat Commun, 2018. 9(1): p. 5290
    [PMID:30538233]