 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
MDP0000171878 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
| Family |
YABBY |
| Protein Properties |
Length: 206aa MW: 22447.4 Da PI: 8.4277 |
| Description |
YABBY family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| MDP0000171878 | genome | GDR | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | YABBY | 163.1 | 2.2e-50 | 13 | 168 | 4 | 163 |
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99
++ se++Cyv+CnfCnt+lav +P + l+ ++tv+CGhC++l ++ + + + +h +sl+ + ++ +e+++ n+ ++ ++s+s ss
MDP0000171878 13 NQPSENLCYVRCNFCNTVLAVGLPCKRLMDTITVKCGHCSNLSFLSTRSPLEGQCLPDH-PTSLTLQESDQYLNEKQAGCCNDFRKGQSSSSSSS- 106
5789*************************************977666666666666666.33444344444445555666666776666666666. PP
YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
+ + + +p++p v++PPek+ r Psaynrf+k+ei+rika+nP++ hreafsaaaknWa +
MDP0000171878 107 --PVSGNPPSPKAPFVVKPPEKKHRLPSAYNRFMKDEIKRIKAANPEVPHREAFSAAAKNWARY 168
..45667789999*************************************************76 PP
|
| Sequence ? help Back to Top |
| Protein Sequence Length: 206 aa
Download sequence Send
to blast |
MSMEEKVTMD FINQPSENLC YVRCNFCNTV LAVGLPCKRL MDTITVKCGH CSNLSFLSTR 60
SPLEGQCLPD HPTSLTLQES DQYLNEKQAG CCNDFRKGQS SSSSSSPVSG NPPSPKAPFV 120
VKPPEKKHRL PSAYNRFMKD EIKRIKAANP EVPHREAFSA AAKNWARYIP SQSSAGSGSG 180
SCSNNNGSDF AGMNMLATCC QNPKTP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269|PubMed:14729915}. |
| Uniprot | DEVELOPMENTAL STAGE: In carpels, expression starts when the gynoecial primordia becomes distinct. First expressed in the lateral region of each carpel. Later resolves into two distinct domains, epidermal and internal. In epidermal tissues, mostly localized on the outer surface, successively from the base to the tip of the gynoecium and finally confined to the valve region before disappearing during last flowering stages. In internal tissues, first confined to four discrete zones adjacent to the future placental tissue occupying the full length of the elongating cylinder, declining from the apical regions and disappearing after the ovule primordia arise. Before nectaries initiation, expression occupies a ring of receptacle cells between the stamen and sepal primordia, from where nectaries will develop. Strongly expressed in nectaries until latest flowering stages. {ECO:0000269|PubMed:10225998}. |
| Uniprot | TISSUE SPECIFICITY: Restricted to flowers, mostly in carpels and nectaries. Expressed at low levels in sepal primordia (buds), sepal receptacle and developing petal. Not detected in placental tissues, septum, stigma and ovules. {ECO:0000269|PubMed:10225998}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
| UniProt | Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AB627250 | 7e-37 | AB627250.1 Malus x domestica mRNA, microsatellite: MEST098, clone: FLW01_10_E08. |
| Publications
? help Back to Top |
- Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C
The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development.
Ann. Bot., 2014. 114(7): p. 1535-44
[PMID:24989787] - Pfannebecker KC,Lange M,Rupp O,Becker A
Seed Plant-Specific Gene Lineages Involved in Carpel Development.
Mol. Biol. Evol., 2017. 34(4): p. 925-942
[PMID:28087776] - Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T
Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation.
Nat Commun, 2017. 8(1): p. 1125
[PMID:29066759] - Yamaguchi N, et al.
Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy.
Nat Commun, 2018. 9(1): p. 5290
[PMID:30538233]
|
