PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000158607 | ||||||||
Common Name | SPL4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 189aa MW: 21271.2 Da PI: 9.5121 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132.5 | 1.4e-41 | 74 | 149 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cq+e+C adl +ak+yhrrhkvCe+hska+vv+vsg++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++ MDP0000158607 74 CQAERCGADLVDAKRYHRRHKVCEFHSKAAVVIVSGTRQRFCQQCSRFHELIEFDEAKRSCRRRLAGHNERRRKSS 149 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 7.5E-34 | 67 | 135 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.086 | 71 | 148 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.49E-38 | 72 | 151 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 9.1E-31 | 74 | 147 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MEGKNFEGRQ TWKEKSKKDV EEVEDDYSDE EETGGGGGGL MLRFEENERQ KKAAAAGRRG 60 SGGGGGGGVX QPSCQAERCG ADLVDAKRYH RRHKVCEFHS KAAVVIVSGT RQRFCQQCSR 120 FHELIEFDEA KRSCRRRLAG HNERRRKSSG EPYGESSSRR VVGHQYKESQ TRYQITPPGN 180 SSSKHCQIR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-36 | 62 | 147 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mdo.11350 | 0.0 | bud |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008386198.2 | 1e-135 | squamosa promoter-binding protein 1 | ||||
Swissprot | Q9S7A9 | 6e-44 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | D9ZJC3 | 1e-134 | D9ZJC3_MALDO; SPL domain class transcription factor | ||||
STRING | XP_008386198.1 | 1e-134 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 9e-46 | squamosa promoter binding protein-like 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000158607 |