PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000060753 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 197aa MW: 22478.9 Da PI: 8.0621 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.4 | 2.1e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g++ e+ss MDP0000060753 9 KRIENDTSRQVTFSKRRNGLLKKAFELSVLCDAEVAVIIFSQKGRINEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 62 | 2.3e-21 | 84 | 170 | 11 | 97 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 e+ +++l++e+a + k+ie L+ +qR+ G++L+ +s++eLq++ +qL +sl +iR++K +l++eq+e+l+ ke+ l +en +L ++ MDP0000060753 84 EQCMQRLKHESAIMAKKIEILEASQRKHSGNGLDFCSVEELQEISSQLGRSLCSIRERKAQLYMEQLEQLKAKERFLLQENAQLCEE 170 566899****************************************************************************99776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.721 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.46E-32 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.75E-41 | 3 | 72 | No hit | No description |
PRINTS | PR00404 | 6.8E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.8E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.8E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.75 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.9E-21 | 87 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MVRGKIEIKR IENDTSRQVT FSKRRNGLLK KAFELSVLCD AEVAVIIFSQ KGRINEFSSS 60 DMHQTIERFH KHVNGGEINM VEVEQCMQRL KHESAIMAKK IEILEASQRK HSGNGLDFCS 120 VEELQEISSQ LGRSLCSIRE RKAQLYMEQL EQLKAKERFL LQENAQLCEE CGAKPLMEFS 180 AQKERAFAPV SCEKAGA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 2e-18 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_B | 2e-18 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_C | 2e-18 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_D | 2e-18 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
5f28_A | 2e-18 | 1 | 72 | 1 | 72 | MEF2C |
5f28_B | 2e-18 | 1 | 72 | 1 | 72 | MEF2C |
5f28_C | 2e-18 | 1 | 72 | 1 | 72 | MEF2C |
5f28_D | 2e-18 | 1 | 72 | 1 | 72 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP164006 | 0.0 | KP164006.1 Pyrus pyrifolia clone PpSOC1-1 SOC1 MADS-box protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009371258.1 | 1e-110 | PREDICTED: MADS-box protein AGL42-like | ||||
Refseq | XP_009371259.1 | 1e-110 | PREDICTED: MADS-box protein AGL42-like | ||||
Swissprot | Q9FIS1 | 2e-66 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A0D4ZY40 | 1e-100 | A0A0D4ZY40_PYRPY; SOC1 MADS-box protein | ||||
STRING | XP_009371258.1 | 1e-109 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 8e-69 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000060753 |