PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_AchrUn_randomP28780_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 149aa MW: 16905.5 Da PI: 10.141 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.5 | 6.3e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv ++k +G g+W++ ++ g+ R++k+c++rw +yl GSMUA_AchrUn_randomP28780_001 14 KGAWTKEEDEKLVSYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 56 | 9.3e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEde +++++ lG++ W++Ia +++ gRt++++k++w+++ GSMUA_AchrUn_randomP28780_001 67 RGNFTEEEDEHIIKLHGVLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.1E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.614 | 9 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 5.9E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.84E-30 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 6.4E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.94E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.462 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-28 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.1E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-15 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.16E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDEKLVSYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDEHIIK LHGVLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLGRG 120 IDPQTHRPIP QQPKTAMVQD MAAAVQAPA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-30 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009387206.1 | 1e-109 | PREDICTED: myb-related protein Zm38-like, partial | ||||
Swissprot | Q9SZP1 | 1e-87 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | M0UD86 | 1e-107 | M0UD86_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_AchrUn_randomP28780_001 | 1e-108 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 4e-89 | myb domain protein 4 |