PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP08220_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NAC
Protein Properties Length: 261aa    MW: 30464.9 Da    PI: 8.4501
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP08220_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.51.6e-46101372128
                            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                     pGfrFhPt+ el+++yL++ v+g+kl++ ++i +++iy+++Pw+Lp  +k +e+ewyfF++rd+k+ +  r+nr+t++g
  GSMUA_AchrUn_randomP08220_001  10 LPGFRFHPTEAELLDFYLRRVVRGEKLDF-DFIGSLNIYHYDPWELPGLAKVGEREWYFFVPRDRKSGNRGRANRTTERG 88 
                                    59**************************9.99***************8888899************************** PP

                            NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                    +Wkatg d+++ s   +++l glkktLvfy+grap+g+ktdW+m+eyrl
  GSMUA_AchrUn_randomP08220_001  89 FWKATGCDRQIRSLadSKHLLGLKKTLVFYQGRAPRGTKTDWIMNEYRL 137
                                    ***********998767888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.9059160IPR003441NAC domain
SuperFamilySSF1019417.32E-569160IPR003441NAC domain
PfamPF023658.9E-2411137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MERNDFELHL PGFRFHPTEA ELLDFYLRRV VRGEKLDFDF IGSLNIYHYD PWELPGLAKV  60
GEREWYFFVP RDRKSGNRGR ANRTTERGFW KATGCDRQIR SLADSKHLLG LKKTLVFYQG  120
RAPRGTKTDW IMNEYRLPDS YSAAISTPQQ VIVLCKIYRK ATSMKELEQR AASEEKRKEA  180
QICSAMADNV SIFSAPSECM DVKEMEAPKK VEVTSTTFRS VKLPELQIPM DSLDWMQDPF  240
LTQLRSPWLD QWSPCANILY F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-441116622174NAC domain-containing protein 19
3swm_B1e-441116622174NAC domain-containing protein 19
3swm_C1e-441116622174NAC domain-containing protein 19
3swm_D1e-441116622174NAC domain-containing protein 19
3swp_A1e-441116622174NAC domain-containing protein 19
3swp_B1e-441116622174NAC domain-containing protein 19
3swp_C1e-441116622174NAC domain-containing protein 19
3swp_D1e-441116622174NAC domain-containing protein 19
3ulx_A8e-45716012168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009386283.10.0PREDICTED: NAC domain-containing protein 35-like
SwissprotQ10S651e-100NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLM0U7D30.0M0U7D3_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP08220_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.15e-86NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]