PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr9P28330_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

MYB

Protein Properties

Length: 322aa MW: 37523.8 Da PI: 9.9942

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr9P28330_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.5	8.3e-15	4	53	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48 r+rW eEd +l +v+q+G++ W++++++m+ ++R +k+c +rw +yl GSMUA_Achr9P28330_001 4 RQRWRSEEDAILCAYVTQYGPREWHLVSQRMNapLHRDAKSCLERWKNYL 53 89**********************************************97 PP
2	Myb_DNA-binding	29.2	2.1e-09	59	103	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+ T+eE+ + + +++G++ Wk+Ia++++ gRt+k + +w + GSMUA_Achr9P28330_001 59 KGSLTEEEQRVVIGLQAKYGNK-WKRIAAEVP-GRTAKRLGKWWEVF 103 57789***************.*****.***999999766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.518	1	57	IPR017930	Myb domain
SMART	SM00717	3.0E-11	3	55	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.47E-20	4	98	IPR009057	Homeodomain-like
CDD	cd00167	2.83E-6	6	53	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.3E-19	6	60	IPR009057	Homeodomain-like
Pfam	PF13921	6.6E-13	7	67	No hit	No description
PROSITE profile	PS51294	17.082	58	108	IPR017930	Myb domain
SMART	SM00717	2.3E-7	58	106	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.6E-14	61	102	IPR009057	Homeodomain-like
CDD	cd00167	1.26E-4	63	104	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 322 aa Download sequence Send to blast
MKERQRWRSE EDAILCAYVT QYGPREWHLV SQRMNAPLHR DAKSCLERWK NYLKPGIKKG 60 SLTEEEQRVV IGLQAKYGNK WKRIAAEVPG RTAKRLGKWW EVFKEKQQRR QRESSSRSAV 120 CSIEPSKYDQ ILENFAEKLV KDHHHISPLL MATPLLPPWL SNNNGAHRPA SPSRAADNSL 180 GSSRLQHGMA PGFTAVDGRM VSDLVECCKE IEEGHRAWMS HKREAAWRLQ RVELQLDAEK 240 AHKRREKMEE TEAKIRALRE EQQAALDRIE AEYREQILGL RRDAEAKEQK LAEQWASKHM 300 RLSKFLEQCG CRQWPSAEMN GR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	1e-15	7	100	7	97	MYB PROTO-ONCOGENE PROTEIN
1mse_C	1e-15	7	92	7	89	C-Myb DNA-Binding Domain
1msf_C	1e-15	7	92	7	89	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for normal cell differentiation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 2 (LBD6/AS2) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11076771, PubMed:11140682, PubMed:11882937, PubMed:12750468, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509, PubMed:23271976). Binds directly to KNAT1, KNAT2, and KNATM chromatin, regulating leaf development (PubMed:23271976). LBD6 is required for this binding (PubMed:23271976). Positive regulator of flowering that binds to the promoter of FT (PubMed:21950734). Regulates FT expression by forming a functional complex with CO (PubMed:21950734). Involved in leaf polarity establishment by functioning cooperatively with NUCL1 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269\|PubMed:11076771, ECO:0000269\|PubMed:11140682, ECO:0000269\|PubMed:11882937, ECO:0000269\|PubMed:12750468, ECO:0000269\|PubMed:16006579, ECO:0000269\|PubMed:16699177, ECO:0000269\|PubMed:17395603, ECO:0000269\|PubMed:17559509, ECO:0000269\|PubMed:23271976, ECO:0000269\|PubMed:27334696}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation with an afternoon peak in long days and with a broad night peak in short days (PubMed:21950734). Expression of AS1 in stem cells of the shoot apical meristem is prevented by SHOOT MERISTEMLESS (STM). Expression is activated by GTE6 during leaf morphogenesis (PubMed:16166385). {ECO:0000269\|PubMed:16166385, ECO:0000269\|PubMed:21950734}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009419262.1	0.0	PREDICTED: protein rough sheath 2 homolog
Swissprot	O80931	1e-133	AS1_ARATH; Transcription factor AS1
TrEMBL	M0U490	0.0	M0U490_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr9P28330_001	0.0	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5190	36	54

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G37630.1	1e-128	MYB family protein

Publications ? help Back to Top
Hazen SP, et al. Rapid array mapping of circadian clock and developmental mutations in Arabidopsis. Plant Physiol., 2005. 138(2): p. 990-7 [PMID:15908595] Pinon V, et al. Three PIGGYBACK genes that specifically influence leaf patterning encode ribosomal proteins. Development, 2008. 135(7): p. 1315-24 [PMID:18305008] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou F,Roy B,Dunlap JR,Enganti R,von Arnim AG Translational control of Arabidopsis meristem stability and organogenesis by the eukaryotic translation factor eIF3h. PLoS ONE, 2014. 9(4): p. e95396 [PMID:24736281] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Ivanova A, et al. A Functional Antagonistic Relationship between Auxin and Mitochondrial Retrograde Signaling Regulates Alternative Oxidase1a Expression in Arabidopsis. Plant Physiol., 2014. 165(3): p. 1233-1254 [PMID:24820025] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Kaurilind E,Xu E,Brosché M A genetic framework for H2O2 induced cell death in Arabidopsis thaliana. BMC Genomics, 2015. 16: p. 837 [PMID:26493993] Mateo-Bonmatí E, et al. Plastid control of abaxial-adaxial patterning. Sci Rep, 2015. 5: p. 15975 [PMID:26522839] Rast-Somssich MI, et al. Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] Guzmán-López JA,Abraham-Juárez MJ,Lozano-Sotomayor P,de Folter S,Simpson J Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity. Plant Mol. Biol., 2016. 91(1-2): p. 37-51 [PMID:26826012] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Matsumura Y, et al. A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis. Biol Open, 2016. 5(7): p. 942-54 [PMID:27334696] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187] Tsukaya H,Uchimiya H Genetic analyses of the formation of the serrated margin of leaf blades in Arabidopsis: combination of a mutational analysis of leaf morphogenesis with the characterization of a specific marker gene expressed in hydathodes and stipules. Mol. Gen. Genet., 1997. 256(3): p. 231-8 [PMID:9393447]