PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P18170_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family ARF
Protein Properties Length: 854aa    MW: 95779.1 Da    PI: 7.1728
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P18170_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.92e-23122223199
                            EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                     B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                            f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+
  GSMUA_Achr9P18170_001 122 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldftMQPPAQ--ELVAKDLHDVSWTFRHIYRGQPKRHLLTTGWSVFVSTKRLSAGDSVL 207
                            99*****************************96555444..8********************************************** PP

                            EEE-SSSEE..EEEEE-S CS
                     B3  82 Fkldgrsefelvvkvfrk 99 
                            F   ++++ +l+++++r+
  GSMUA_Achr9P18170_001 208 FI--RDEKSQLLLGIRRA 223
                            **..45677789999997 PP

2Auxin_resp125.53.6e-41248330183
             Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                            aahaa+++s+F+++YnPras+seFv++++k++ka++++vs+GmRf+m+feteds  rr++Gt++g+sdldpvrW+nS+Wr+L+
  GSMUA_Achr9P18170_001 248 AAHAATNNSPFTIFYNPRASRSEFVIPLAKYNKAIYTQVSLGMRFRMMFETEDSGVRRYMGTITGISDLDPVRWKNSQWRNLQ 330
                            79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.29E-44112251IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.8E-41114237IPR015300DNA-binding pseudobarrel domain
CDDcd100172.90E-20121222No hitNo description
SMARTSM010192.6E-23122224IPR003340B3 DNA binding domain
PfamPF023621.4E-21122223IPR003340B3 DNA binding domain
PROSITE profilePS5086312.464122224IPR003340B3 DNA binding domain
PfamPF065076.8E-36248330IPR010525Auxin response factor
PROSITE profilePS5174524.528727811IPR000270PB1 domain
PfamPF023092.9E-8728813IPR033389AUX/IAA domain
SuperFamilySSF542775.4E-9729806No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 854 aa     Download sequence    Send to blast
MIVCATVCEA GEKKRIDSEL WHACAGPLVS LPPVGSLVVY FPQGHSEQVA ATMQKEIDGI  60
PNYPSLPSKL ICVLLDVTMH ADAETDEVYA QMTLQPVNKY DREAMLASEI GLKQNKQPAE  120
FFCKTLTASD TSTHGGFSVP RRAAEKIFPA LDFTMQPPAQ ELVAKDLHDV SWTFRHIYRG  180
QPKRHLLTTG WSVFVSTKRL SAGDSVLFIR DEKSQLLLGI RRANRQQHAL SSSVLSSDSM  240
HIGILAAAAH AATNNSPFTI FYNPRASRSE FVIPLAKYNK AIYTQVSLGM RFRMMFETED  300
SGVRRYMGTI TGISDLDPVR WKNSQWRNLQ VGWDESTATE RRTRVSIWEI EPVVTPFYMC  360
PPPYLRPNFA TSPGVPGRQV INQGHVIISP IPHVSYRGQE LFSLFYLLNH IFCKRKSFLN  420
DTFYIEHFVN FNFLERSIDN TSIYWKNSQT TQDGVVTEDP TKMLSFQTPA ASGPSFNSKS  480
SPQAQLNQTL QLPHQLQQQP HLLTQSSVSM QHQLQSSPLQ QKSINLQQQQ FQQPGQLQHQ  540
SPLPQILPLS PPLQSQLSQQ LTQQNQHFQD FQQQLDGSNL LPLQSDQLHQ AHKSSALDSQ  600
KSPLLLRTQS SLSGTNVPCS SNFPSTNSNI DSLSLHNHRD NFLLGTMPDT LLSRGLGTRK  660
DIQNLVSGYG QQKDIDTELS TADISSQSFG VPDMSFKPGC STDVVVTEGV LNRGVWANQP  720
PPPPRMRTYT KVQKRGSVGR CIDVTRYKGY DDLRRDLARM FGIEGQLEDT YRTDWKLVYV  780
DHENDILLVG DDPWEEFVSC VQSIKILSAA EVQQMSLDGN LTSLSVRTEA CSGSNSGNPW  840
RGQFDDASFA SFHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1661335148388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009418003.10.0PREDICTED: auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLM0U1C40.0M0U1C4_MUSAM; Auxin response factor
STRINGGSMUA_Achr9P18170_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]