PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr9P14850_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 187aa MW: 21816.4 Da PI: 10.909 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61 | 2.5e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv++++++G g+W++ ++ g++R++k+c++rw +yl GSMUA_Achr9P14850_001 14 KGPWTPEEDHKLVRYIQKHGRGSWRSLPKLAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 57.9 | 2.4e-18 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgr+++eE++ +++++ lG++ W++Ia++++ gRt++++k++w+++l GSMUA_Achr9P14850_001 67 RGRFSAEEEQTILNLHSILGNK-WSSIASHLP-GRTDNEIKNFWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.872 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.77E-32 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.5E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.07E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.731 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-28 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.1E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.79E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MGRSPCCDEN GLKKGPWTPE EDHKLVRYIQ KHGRGSWRSL PKLAGLNRCG KSCRLRWTNY 60 LRPDIKRGRF SAEEEQTILN LHSILGNKWS SIASHLPGRT DNEIKNFWNT HLKKKLIQMG 120 FDPMTHRPRT DFFATLQQLI AHLLALKNIV DALVKLQTVR VETHLHLQRK QRLQIKDVML 180 PLPYPSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-29 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009417580.1 | 1e-103 | PREDICTED: transcription factor MYB39-like | ||||
Swissprot | Q9S9Z2 | 4e-92 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | M0U0E3 | 1e-136 | M0U0E3_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr9P14850_001 | 1e-137 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1126 | 37 | 132 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34670.1 | 2e-94 | myb domain protein 93 |
Publications ? help Back to Top | |||
---|---|---|---|
|