PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr9P09280_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 93aa MW: 10922.5 Da PI: 9.6858 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 42.6 | 1.4e-13 | 11 | 65 | 6 | 60 |
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 rerrkq NRe+ArrsR RK++e e ++ +++L++eN+ Lk ++e l k ++ l+ GSMUA_Achr9P09280_001 11 RERRKQANRESARRSRIRKRQEYEDSARMMAVLKNENDVLKAKNEILMKRIKDLE 65 8************************************************999886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 6.8E-8 | 6 | 70 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.0E-11 | 7 | 65 | No hit | No description |
PROSITE profile | PS50217 | 10.289 | 8 | 65 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 1.75E-11 | 11 | 60 | No hit | No description |
SuperFamily | SSF57959 | 9.85E-8 | 11 | 64 | No hit | No description |
Pfam | PF00170 | 6.6E-11 | 11 | 65 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 13 | 28 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MEGLLDDDEF RERRKQANRE SARRSRIRKR QEYEDSARMM AVLKNENDVL KAKNEILMKR 60 IKDLEAGSIR IMEILSGLYW PADTLDALGI RPS |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009416840.1 | 4e-56 | PREDICTED: DNA-binding protein EMBP-1-like isoform X1 | ||||
TrEMBL | M0TYT7 | 5e-59 | M0TYT7_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr9P09280_001 | 8e-60 | (Musa acuminata) |