PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr9P07230_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 115aa MW: 13710.6 Da PI: 10.1897 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 107.6 | 6.1e-34 | 38 | 96 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +ve+tYeg Hnh+ GSMUA_Achr9P07230_001 38 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDEGIVETTYEGVHNHT 96 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.4E-34 | 23 | 96 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.76E-30 | 30 | 96 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.207 | 33 | 98 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.6E-40 | 38 | 97 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-27 | 39 | 95 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MLLIFLFVPN SSRTQGKIWK NMQKQRYAFH TRSHVDILDD GYRWRKYGQK AVKNNKFPRS 60 YYRCTHQGCN VKKQVQRLSK DEGIVETTYE GVHNHTTEKP IDSFGHVLEQ MQIYS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-27 | 28 | 95 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-27 | 28 | 95 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK354853 | 9e-38 | AK354853.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1012D01. | |||
GenBank | AK364290 | 9e-38 | AK364290.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2023H16. | |||
GenBank | DQ840411 | 9e-38 | DQ840411.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 12 (WRKY12) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009416583.1 | 4e-66 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 3e-48 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | M0TY82 | 2e-82 | M0TY82_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr9P07230_001 | 4e-83 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1100 | 38 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 1e-50 | WRKY DNA-binding protein 75 |