PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr9P05660_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 96aa MW: 10247.7 Da PI: 4.5381 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 24 | 1e-07 | 14 | 48 | 2 | 36 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHH CS HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvldeeef 36 Fl+k+ye+++d ++++++sws + fvv+++ e+ GSMUA_Achr9P05660_001 14 FLTKTYEMVDDLSTNSIVSWSPINAGFVVWKQLEL 48 9********************999******99776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 6.1E-9 | 7 | 48 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 6.39E-6 | 9 | 49 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 8.1E-5 | 14 | 49 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MEGSRGSSNS PSPFLTKTYE MVDDLSTNSI VSWSPINAGF VVWKQLELLG ICSPSISSTI 60 ISPASSGCSI LKVSERLTLI GGSLQMTISN EDKSIY |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018683306.1 | 1e-17 | PREDICTED: heat stress transcription factor A-4b-like | ||||
TrEMBL | M0TXS5 | 5e-61 | M0TXS5_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr9P05660_001 | 8e-62 | (Musa acuminata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G32330.1 | 8e-14 | heat shock transcription factor A1D |