PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr9P00570_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

NAC

Protein Properties

Length: 168aa MW: 19540.3 Da PI: 9.4264

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr9P00570_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	156.2	1.4e-48	16	162	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....................kvkaeekewyfFskrdkk 67 lp GfrF+Ptdeel+++yL++kv++ + + + ++ d++k+ePwdLp + ++++e+yfFs +d+k GSMUA_Achr9P00570_001 16 LPSGFRFNPTDEELITCYLTRKVTDMGFVA-RNNADDDLNKCEPWDLPDscvvrkllrtrcfadvlcregQGVGRKSECYFFSMKDRK 102 699**********************998.667888*******558999999999999888765432336679****** PP NAM 68 yatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + tg r+nr t+sgyWkatgkdke+++ +g vg+kktLvfykgrap+gekt+Wvmheyrl GSMUA_Achr9P00570_001 103 NLTGLRTNRDTDSGYWKATGKDKEIFR-RGVSVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 162 ***********************.999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.58E-48	12	166	IPR003441	NAC domain
PROSITE profile	PS51005	45.127	16	168	IPR003441	NAC domain
Pfam	PF02365	1.1E-27	17	162	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 168 aa Download sequence Send to blast
MYAREILARN GGEPYLPSGF RFNPTDEELI TCYLTRKVTD MGFVARNNAD DDLNKCEPWD 60 LPDSCVVRKL LRTRCFADVL CREGQGVGRK SECYFFSMKD RKNLTGLRTN RDTDSGYWKA 120 TGKDKEIFRR GVSVGMKKTL VFYKGRAPRG EKTNWVMHEY RLQSEFPH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	5e-38	16	162	17	142	NO APICAL MERISTEM PROTEIN
1ut4_B	5e-38	16	162	17	142	NO APICAL MERISTEM PROTEIN
1ut7_A	5e-38	16	162	17	142	NO APICAL MERISTEM PROTEIN
1ut7_B	5e-38	16	162	17	142	NO APICAL MERISTEM PROTEIN
3swm_A	5e-38	16	162	20	145	NAC domain-containing protein 19
3swm_B	5e-38	16	162	20	145	NAC domain-containing protein 19
3swm_C	5e-38	16	162	20	145	NAC domain-containing protein 19
3swm_D	5e-38	16	162	20	145	NAC domain-containing protein 19
3swp_A	5e-38	16	162	20	145	NAC domain-containing protein 19
3swp_B	5e-38	16	162	20	145	NAC domain-containing protein 19
3swp_C	5e-38	16	162	20	145	NAC domain-containing protein 19
3swp_D	5e-38	16	162	20	145	NAC domain-containing protein 19
4dul_A	5e-38	16	162	17	142	NAC domain-containing protein 19
4dul_B	5e-38	16	162	17	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269\|PubMed:27021284}.
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020097045.1	4e-64	NAC domain-containing protein 92 isoform X1
Refseq	XP_020097046.1	2e-64	protein CUP-SHAPED COTYLEDON 2 isoform X2
Swissprot	O04017	1e-52	NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
Swissprot	Q9FK44	8e-53	NAC87_ARATH; NAC domain-containing protein 87
TrEMBL	M0TWB4	1e-122	M0TWB4_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr9P00570_001	1e-123	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP23139	5	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G18400.1	9e-62	NAC domain containing protein 58

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Vialette-Guiraud AC, et al. A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids. Front Plant Sci, 2015. 6: p. 1239 [PMID:26793217] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Blein T,Pautot V,Laufs P Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374] Biot E, et al. Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis. Development, 2016. 143(18): p. 3417-28 [PMID:27387872] Zheng M, et al. Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development. Plant Physiol., 2016. 172(2): p. 1117-1130 [PMID:27535792] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292] Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves. New Phytol., 2018. 217(3): p. 1307-1321 [PMID:29139551] Gonçalves B, et al. GDP-L-fucose is required for boundary definition in plants. J. Exp. Bot., 2017. 68(21-22): p. 5801-5811 [PMID:29186469] Sha S, et al. To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes. Ann. Bot., 2018. 121(2): p. 255-266 [PMID:29267935] Maugarny-Calès A, et al. Dissecting the pathways coordinating patterning and growth by plant boundary domains. PLoS Genet., 2019. 15(1): p. e1007913 [PMID:30677017]