PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P17250_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 343aa    MW: 37895.4 Da    PI: 6.5908
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P17250_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
  GSMUA_Achr7P17250_001 14 KGLWSPEEDEKLIKHITTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                           678*******************************************97 PP

2Myb_DNA-binding44.73e-1467110146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg+++ +E++l++++++ lG++ W+ Ia +++ gRt++++k+ w++
  GSMUA_Achr7P17250_001  67 RGAFSDQEEDLIIELHAVLGNR-WSQIATRLP-GRTDNEIKNLWNS 110
                            89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.32961IPR017930Myb domain
SuperFamilySSF466891.46E-2812108IPR009057Homeodomain-like
SMARTSM007174.4E-131363IPR001005SANT/Myb domain
PfamPF002494.1E-151461IPR001005SANT/Myb domain
CDDcd001675.14E-121761No hitNo description
PROSITE profilePS5129424.78662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2565117IPR009057Homeodomain-like
SMARTSM007172.7E-1266114IPR001005SANT/Myb domain
PfamPF002493.9E-1367110IPR001005SANT/Myb domain
CDDcd001672.67E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRHTCCHKQ KLRKGLWSPE EDEKLIKHIT TYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SDQEEDLIIE LHAVLGNRWS QIATRLPGRT DNEIKNLWNS CIKKKLKQRG  120
IDPNTHKPLA EAEASEDQAS KSSERTSSSC DLKVPIATLE STTDAVRTSS SMPISQAATA  180
GLSVCPNPYG RLFEMNQDSS CNTLSTGFPS TPTAVISTSM GVRTNINLPL YNPAHVCAGI  240
DGIRYSDAVY SSNTSQSSIS SVGGIEMQNS SPFFDNGFFP WSELTPDTDT QVQLEGEPED  300
LKWSEYLEGG FPSDVGTWHQ HQLQSPDVYG KDFRISSVGF GQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409912.10.0PREDICTED: transcription factor MYB86-like
SwissprotQ8VZQ22e-88MYB61_ARATH; Transcription factor MYB61
TrEMBLM0TIB20.0M0TIB2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P17250_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.14e-90myb domain protein 61
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Matías-Hernández L, et al.
    AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.
    Plant J., 2017. 90(3): p. 520-534
    [PMID:28207974]