PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr7P06860_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

WRKY

Protein Properties

Length: 117aa MW: 14072 Da PI: 9.6804

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr7P06860_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.2	7.1e-33	43	101	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+ GSMUA_Achr7P06860_001 43 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHS 101 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	2.3E-34	28	101	IPR003657	WRKY domain
SuperFamily	SSF118290	3.53E-29	35	101	IPR003657	WRKY domain
PROSITE profile	PS50811	28.897	38	100	IPR003657	WRKY domain
SMART	SM00774	7.5E-38	43	102	IPR003657	WRKY domain
Pfam	PF03106	8.5E-26	44	100	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MEMIIYVPSR WRGSSLEKGK VKVKRKMREP RFCFQTRSDV DVLDDGYKWR KYGQKVVKNS 60 LHPRSYYRCT HNNCRVKKRV ERLSEDCRMV ITTYEGRHTH SPCDDENSSE HECFSSF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-26	34	100	8	74	Probable WRKY transcription factor 4
2lex_A	2e-26	34	100	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009407832.1	2e-75	PREDICTED: probable WRKY transcription factor 12 isoform X2
Swissprot	Q93WY4	3e-62	WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBL	M0TFC6	9e-82	M0TFC6_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr7P06860_001	1e-82	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1138	38	130

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G44745.1	1e-64	WRKY family protein

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Yang L, et al. PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa. Sci Rep, 2016. 6: p. 18643 [PMID:26819184] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Han Y, et al. WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 149-159 [PMID:30617455]