PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr6P27520_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 153aa MW: 17808.4 Da PI: 10.0004 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 130.4 | 6.6e-41 | 42 | 118 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 C v+gC++dl +++eyhrrhkvCe hsk+pvv+v g+eqrfCqqCsrfh l efDe krsCr+rL++hn+rrrk+++ GSMUA_Achr6P27520_001 42 CLVDGCRSDLRNCREYHRRHKVCELHSKTPVVMVGGVEQRFCQQCSRFHPLVEFDEVKRSCRKRLDGHNQRRRKPRS 118 9*************************************************************************875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.4E-32 | 36 | 103 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.359 | 39 | 116 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.77E-38 | 40 | 119 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.3E-31 | 42 | 115 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MSYIFACHFF QKLILHFPFV SSSGARKRAQ PPSTASRNRV WCLVDGCRSD LRNCREYHRR 60 HKVCELHSKT PVVMVGGVEQ RFCQQCSRFH PLVEFDEVKR SCRKRLDGHN QRRRKPRSEE 120 ASTASACLHP LPPGFIFSSL VSLSFNRTCD DYF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-30 | 32 | 115 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009407039.1 | 6e-80 | PREDICTED: squamosa promoter-binding-like protein 16 | ||||
Swissprot | B9DI20 | 1e-38 | SP13A_ARATH; Squamosa promoter-binding-like protein 13A | ||||
Swissprot | P0DI11 | 1e-38 | SP13B_ARATH; Squamosa promoter-binding-like protein 13B | ||||
TrEMBL | M0TAP7 | 1e-109 | M0TAP7_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr6P27520_001 | 1e-109 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12961 | 25 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 6e-41 | SBP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|