PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr6P02690_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 250aa MW: 27971.7 Da PI: 8.3362 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.4 | 2.4e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+ lv +++q+G+g+Wk+ + g+ R+ k+c++rw +yl GSMUA_Achr6P02690_001 14 KGPWTPEEDLMLVSYIQQHGPGNWKAAPTQTGLMRCSKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 56.1 | 8.7e-18 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E++l+v++ ++lG++ W++Ia++++ +Rt++++k++w+++l GSMUA_Achr6P02690_001 67 RGNFTEQEEKLIVHLQALLGNR-WAAIASYLP-KRTDNDIKNHWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.026 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.81E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.6E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.57E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.491 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-24 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.0E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.31E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MGRSPCCDKV GVKKGPWTPE EDLMLVSYIQ QHGPGNWKAA PTQTGLMRCS KSCRLRWTNY 60 LRPGIKRGNF TEQEEKLIVH LQALLGNRWA AIASYLPKRT DNDIKNHWNT HLKKKLRTAP 120 DHLEANLNKD AFSIHQPVSK GHSPVPSTTS YASSTENISR LLGEWMKNPP KKRTLGTEPA 180 TVADSNDHNN KTTVLAEKLN SLLSDIESSA SMVSESEHLP LLETWLFDES LGQGNAALVE 240 MPLDYTAELF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-27 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 3e-27 | 14 | 116 | 27 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 2e-27 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 2e-27 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 111 | 117 | LKKKLRT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:21637967}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:21637967, ECO:0000269|PubMed:23453954, ECO:0000269|PubMed:23828545, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009403168.1 | 1e-180 | PREDICTED: transcription factor MYB30-like | ||||
Swissprot | Q8GYP5 | 2e-82 | MYB60_ARATH; Transcription factor MYB60 | ||||
TrEMBL | M0T3L7 | 0.0 | M0T3L7_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr6P02690_001 | 0.0 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 6e-85 | myb domain protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|