PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr5P21840_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 207aa MW: 23511.2 Da PI: 8.6734 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41.9 | 2.3e-13 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eE +l+ +++++G g W + ++++g++R++k+c++rw++yl GSMUA_Achr5P21840_001 14 KGAWSPEEAAKLKAYIEEHGIGaYWLSLPHKIGLKRCGKSCRLRWLNYL 62 79*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 36.7 | 9.8e-12 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++eEd+ + + G++ W+ Ia+ + gRt++++k++w++ GSMUA_Achr5P21840_001 69 GGFSEEEDQVICSLYISIGSR-WSMIAAQLL-GRTDNDVKNHWNT 111 569******************.********9.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.291 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.94E-23 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-6 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-11 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-20 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.34E-7 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 19.801 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 2.3E-9 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-9 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-21 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.86E-7 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MGRAPCCDKA NVKKGAWSPE EAAKLKAYIE EHGIGAYWLS LPHKIGLKRC GKSCRLRWLN 60 YLRHNIKHGG FSEEEDQVIC SLYISIGSRW SMIAAQLLGR TDNDVKNHWN TRLKKKLLGM 120 QTEPSQSPCL PAQTLSASAL QRMQLLYAFF LSNIPALGGK LLETSHQTLP QMEQEIQISM 180 SQIVQEDMDC SWHGVHPLQY LMMETRV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-21 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009402038.1 | 1e-155 | PREDICTED: transcription factor RAX3-like | ||||
Swissprot | Q9FKL2 | 6e-72 | MYB36_ARATH; Transcription factor MYB36 | ||||
TrEMBL | M0T0K9 | 1e-153 | M0T0K9_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr5P21840_001 | 1e-154 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP135 | 38 | 412 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G57620.1 | 3e-74 | myb domain protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|