PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P19060_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NAC
Protein Properties Length: 244aa    MW: 28184.7 Da    PI: 6.6856
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P19060_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.24.3e-46111373128
                    NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                            pGfrFhPt+e+l+++yL++ ++g++ ++ ++i  +diy+++Pw+Lp  +k +e+ewyfF++r++k+++g r++r t+ g+Wkatg+d+
  GSMUA_Achr5P19060_001  11 PGFRFHPTEEQLLDFYLRRVATGESASF-DIIGVLDIYRHDPWELPGLAKIGEREWYFFVPRERKSRSGGRPSRRTEGGFWKATGSDR 97 
                            9***********************9888.99***************8888899*********************************** PP

                    NAM  91 evlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            ++ s+   ++++glkktLvfy+grap+g++tdW+m+eyrl
  GSMUA_Achr5P19060_001  98 TIRSAaePRRVIGLKKTLVFYRGRAPRGTRTDWIMNEYRL 137
                            ***98766778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.3639160IPR003441NAC domain
SuperFamilySSF1019414.32E-5610160IPR003441NAC domain
PfamPF023651.3E-2311137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MERTVLGFEL PGFRFHPTEE QLLDFYLRRV ATGESASFDI IGVLDIYRHD PWELPGLAKI  60
GEREWYFFVP RERKSRSGGR PSRRTEGGFW KATGSDRTIR SAAEPRRVIG LKKTLVFYRG  120
RAPRGTRTDW IMNEYRLQED CTSAGVPLVE HMVLCKVYRK ATSLKELEQR AAKEEDTKAC  180
NSDQDNYHSP SNPLDSGELK ETKEEVVKEV EVSSSSAGVE WMQEPFITQP WMDHWSPYAN  240
TLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-491116619171NO APICAL MERISTEM PROTEIN
1ut4_B3e-491116619171NO APICAL MERISTEM PROTEIN
1ut7_A3e-491116619171NO APICAL MERISTEM PROTEIN
1ut7_B3e-491116619171NO APICAL MERISTEM PROTEIN
3swm_A3e-491116622174NAC domain-containing protein 19
3swm_B3e-491116622174NAC domain-containing protein 19
3swm_C3e-491116622174NAC domain-containing protein 19
3swm_D3e-491116622174NAC domain-containing protein 19
3swp_A3e-491116622174NAC domain-containing protein 19
3swp_B3e-491116622174NAC domain-containing protein 19
3swp_C3e-491116622174NAC domain-containing protein 19
3swp_D3e-491116622174NAC domain-containing protein 19
4dul_A3e-491116619171NAC domain-containing protein 19
4dul_B3e-491116619171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009401884.10.0PREDICTED: NAC domain-containing protein 35-like isoform X1
SwissprotQ10S654e-90NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLM0SZT50.0M0SZT5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P19060_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.19e-73NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]