PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P29410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 279aa    MW: 31452.6 Da    PI: 7.1789
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P29410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151562148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEd++l d++  +G g+W++++ + g+ R +k+c++rw +yl
  GSMUA_Achr4P29410_001 15 KGLWSPEEDQRLRDYILAHGHGCWSSVPVKAGLQRNGKSCRLRWINYL 62
                           678*******************************************97 PP

2Myb_DNA-binding51.32.6e-1668112147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            r ++T eE+  + ++++ +G++ W++Ia +++ gRt++++k++w+++
  GSMUA_Achr4P29410_001  68 RSAFTHEEEAMIMKLHAIMGNK-WSRIAMHLP-GRTDNEVKNHWNTH 112
                            789*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0611062IPR017930Myb domain
SuperFamilySSF466897.11E-2912109IPR009057Homeodomain-like
SMARTSM007171.7E-101464IPR001005SANT/Myb domain
PfamPF002492.4E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-211669IPR009057Homeodomain-like
CDDcd001672.78E-91862No hitNo description
PROSITE profilePS5129426.69163117IPR017930Myb domain
SMARTSM007171.6E-1567115IPR001005SANT/Myb domain
PfamPF002492.3E-1468112IPR001005SANT/Myb domain
CDDcd001675.15E-1270113No hitNo description
Gene3DG3DSA:1.10.10.609.9E-2670116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGCKMCEKPK VNHRKGLWSP EEDQRLRDYI LAHGHGCWSS VPVKAGLQRN GKSCRLRWIN  60
YLRPGLKRSA FTHEEEAMIM KLHAIMGNKW SRIAMHLPGR TDNEVKNHWN THVKKKAIKI  120
DGSASHDTMA KSLGSDDQSL RMEQFLDENN SQILLSETSA SLESFSPIPC QSILNVTNHA  180
QSQRTPQPPL PKVLFEDWLP MFSDNGGVNR RQESTSNSEA LSPQLLQLDM ISTDDFLHGF  240
EAISNSGGLI QPQYGPVDLV SSNETYAGFE STHHMFVDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25151177108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009398854.10.0PREDICTED: myb-related protein 308-like isoform X1
SwissprotQ9M0K47e-55LAF1_ARATH; Transcription factor LAF1
TrEMBLM0ST530.0M0ST53_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P29410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.13e-57myb domain protein 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]