PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P28850_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 272aa    MW: 30710.4 Da    PI: 4.6941
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P28850_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.4e-171663148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  GSMUA_Achr4P28850_001 16 KGTWTEEEDMKLIAYIHKYGHQNWRALPKLAGLLRCGKSCRLRWTNYL 63
                           799*****************************99************97 PP

2Myb_DNA-binding51.32.7e-1669114148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T++E++ +++++++lG++ W++Ia+ ++ gRt++++k+ w+++l
  GSMUA_Achr4P28850_001  69 RGNFTKDEEDTIIKLHALLGNK-WSKIASFLP-GRTDNEIKNVWNTHL 114
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-24766IPR009057Homeodomain-like
PROSITE profilePS5129416.0481163IPR017930Myb domain
SuperFamilySSF466891.62E-3013110IPR009057Homeodomain-like
SMARTSM007172.4E-141565IPR001005SANT/Myb domain
PfamPF002496.0E-161663IPR001005SANT/Myb domain
CDDcd001672.40E-111863No hitNo description
PROSITE profilePS5129425.48564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2667117IPR009057Homeodomain-like
SMARTSM007179.1E-1568116IPR001005SANT/Myb domain
PfamPF002493.1E-1569114IPR001005SANT/Myb domain
CDDcd001671.45E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRGRAPCCE KIGLNKGTWT EEEDMKLIAY IHKYGHQNWR ALPKLAGLLR CGKSCRLRWT  60
NYLRPDIKRG NFTKDEEDTI IKLHALLGNK WSKIASFLPG RTDNEIKNVW NTHLKKRAAS  120
GEQQPVTNGA STSTGDRMAG AIEIPVDPTV DMFVILDDAL STSMQSNEME DSVFLETLGV  180
RQDSLWTSPQ KQSRGSVASV GTDGPSIPDV RQPEACEEAD GTRRDGQREE WLDYLEKELG  240
LRDEGEAWDR WDEMEGDLVA TFLQDDIFSP YD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018680351.10.0PREDICTED: myb-related protein 330-like
TrEMBLM0SSZ70.0M0SSZ7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P28850_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.16e-68myb domain protein 58