PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr4P21900_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 187aa MW: 21728.3 Da PI: 8.984 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 135.7 | 3.1e-42 | 11 | 138 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratk..sgyWkat 86 p+Gf+F Ptd el+ +yL++k++g++l+ +++++v++y+++P dL +k++ +e +w+fF++r++ky++g r+nr+t +gyWkat GSMUA_Achr4P21900_001 11 PAGFHFVPTDGELIGHYLRAKLDGEDLQY-KAFNDVKLYDYHPADLVEKYEDyGEGRWFFFTSRERKYPNGIRPNRTTCdgDGYWKAT 97 89**************************9.88**************8655553666********************8876689***** PP NAM 87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 g++k ++ +++ vg++++Lvfy+g+a +g+ktdW+m+ey+ GSMUA_Achr4P21900_001 98 GTEKIIYY-NRKPVGIRRSLVFYTGKAGNGQKTDWIMQEYTT 138 ******99.999****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.14E-46 | 8 | 146 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 43.273 | 10 | 171 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.7E-22 | 11 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MERRGPISQF PAGFHFVPTD GELIGHYLRA KLDGEDLQYK AFNDVKLYDY HPADLVEKYE 60 DYGEGRWFFF TSRERKYPNG IRPNRTTCDG DGYWKATGTE KIIYYNRKPV GIRRSLVFYT 120 GKAGNGQKTD WIMQEYTTKS TSNKPHRNSD GSHQPHRNSD GSMQVSIIFK ICFRLDSSMI 180 NGCNDIW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-36 | 1 | 136 | 6 | 140 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-36 | 1 | 136 | 6 | 140 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-36 | 1 | 136 | 6 | 140 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-36 | 1 | 136 | 6 | 140 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-36 | 1 | 136 | 9 | 143 | NAC domain-containing protein 19 |
3swm_B | 1e-36 | 1 | 136 | 9 | 143 | NAC domain-containing protein 19 |
3swm_C | 1e-36 | 1 | 136 | 9 | 143 | NAC domain-containing protein 19 |
3swm_D | 1e-36 | 1 | 136 | 9 | 143 | NAC domain-containing protein 19 |
3swp_A | 1e-36 | 1 | 136 | 9 | 143 | NAC domain-containing protein 19 |
3swp_B | 1e-36 | 1 | 136 | 9 | 143 | NAC domain-containing protein 19 |
3swp_C | 1e-36 | 1 | 136 | 9 | 143 | NAC domain-containing protein 19 |
3swp_D | 1e-36 | 1 | 136 | 9 | 143 | NAC domain-containing protein 19 |
4dul_A | 1e-36 | 1 | 136 | 6 | 140 | NAC domain-containing protein 19 |
4dul_B | 1e-36 | 1 | 136 | 6 | 140 | NAC domain-containing protein 19 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010917234.1 | 1e-56 | NAC domain-containing protein 1-like | ||||
TrEMBL | M0SR03 | 1e-139 | M0SR03_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr4P21900_001 | 1e-140 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP15867 | 13 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G27410.2 | 1e-39 | NAC family protein |